CAZyme Information: ASPCADRAFT_211902-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_211902-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	KV907515|CGC1	37990.01	8.8340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907515:277465-278606(-)

Full Sequence      

MAHTRMRLLLAVILLFILTCLLAPFLWNLYLLLRLPFVWKGSSADAIITQEHDGFDVTFA
TYNSTYATADAGHPVLIPTRLHHVHLGSEPLRPEWKAARDECLKQHPDWEVFFWDDRNAT
RFVQNHYPHILPTWDSYSHLVQRVDAVRYMILYTYGGAILDFDMACKRSLEPLRRFDFVA
PAANPVGISIGMMLASPNNTYVGDLVRNLPTFNRRWSLLPYITVMFSTGCHYASTIYTMQ
RNTSHLRILTGLPDNPKLHMLNGPVDTPLFRHLGSSSWHEMDAKLIKSFANFDQRLSFGM
VLVAGAAAMWALGLCVSRIRRWGRREGWVEGA

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_211902-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	94	174	1.2e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.23e-22	45	288	46	290	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.83e-15	94	173	3	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05573.1|GT32	2.01e-189	1	326	1	326
BCS17124.1|GT32	2.01e-189	1	326	1	326
CAK44892.1|GT32	4.35e-183	1	316	1	316
QMW48357.1|GT32	1.04e-135	1	320	1	320
UDD65563.1|GT32	2.42e-134	1	320	1	320

PDB Hits     

ASPCADRAFT_211902-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.83e-35	74	291	52	264	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.10e-33	26	327	23	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	4.50e-33	62	291	50	272	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.17e-32	77	286	57	262	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.60e-30	71	286	77	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999891	0.000138

TMHMM  Annotations     

Start	End
9	31
297	316