CAZyme Information: ASPCADRAFT_211276-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_211276-t33_1-p1
• CAZy Family: GH47
• CAZyme Description: glycoside hydrolase family 93 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	KV907511|CGC3	41211.05	6.2177

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907511:631570-632694(+)

Full Sequence      

MPGHFGQKILNSFGLDHHHGHGHGHGQGQGYPPPGDNRLSGNRILHNDERLLSNHPAGTY
PRLARLSDGRILASFTRFYGGGERALLVSISTDNGHTFIDHGEVTRGHGDVDNMFLLEVS
PGTVLAAFRNHDIGPSGPTHFRITVCRSFDCGHTWSFASQAAEKPAPLGIWEPFMRLGRR
PGEIQLTYSQEFAHNNQCTMLVRSYDQGSSWSEPQCLHGAEDPRRDGMNGIARTWDNGRE
VLAMVFETTSYGTFDVEMLLSYDDGETWGWRQQVYVPPQGRNAGAPQIASLGDGSLAVIF
MTDEDCEEVSWTGNACVKVVFAGAPSEGRVMWTRPTTVCGDMSHWPGIFALDERRLLALY
ECGGPKAKTIALEM

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_211276-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	57	316	9.1e-68	0.8990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.88e-13	116	306	19	222	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.70e-09	61	367	17	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	2.72e-08	65	246	152	335	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	7.95e-05	53	156	194	294	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	3.80e-04	199	316	82	195	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	2.01e-234	1	373	1	376
BCS11580.1|GH93	2.01e-234	1	373	1	376
BCS24955.1|GH93	3.65e-176	1	372	1	364
QMW42642.1|GH93	3.47e-175	1	372	1	378
QMW30589.1|GH93	3.47e-175	1	372	1	378

PDB Hits     

ASPCADRAFT_211276-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPCADRAFT_211276-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_211276-t33_1-p1.