CAZyme Information: ASPCADRAFT_210467-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_210467-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: glycoside hydrolase family 12 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		26723.47	3.6423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907508:130129-130915(-)

Full Sequence      

MNRFSVLCLASAVPALAGLAARDPIATICTKNNIITTDDFILYNNLWGEDTATSGSECTY
LDYDSGNSISWQTSWTWAGGSSEVKSYPNAVLNVGAKQLSTITTIPSTWSWSYTGNDLVA
DVSYDAFFSSSDSTTATHDYEVMIWLAAYGGIQPIGYSDGPIASPTIGGYTWDLYKGPNT
WTVYSFVARETVTDFSGDIMEFFTYLIDDEGVPSSYYLQTLGAGTEPMTGSDAWFTVAPY
TISINT

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	97	244	4.8e-43	0.9807692307692307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	2.20e-49	44	245	7	207	Glycosyl hydrolase family 12.
235746	PRK06215	4.98e-16	3	187	16	180	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG17892.1|GH12	3.21e-162	1	246	1	248
CAK38314.1|GH12	3.21e-162	1	246	1	248
BCS12351.1|GH12	1.86e-161	7	246	9	248
BCS00584.1|GH12	1.86e-161	7	246	9	248
CAK36874.1|GH12	4.64e-88	11	244	7	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VL8_A	1.04e-77	18	244	4	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	2.35e-77	29	244	8	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
4NPR_A	7.04e-74	29	244	28	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
6K9D_A	2.29e-61	27	245	2	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	5.41e-60	27	245	3	219	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2Q877|XGEA_ASPNC	8.24e-89	11	244	7	240	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xgeA PE=3 SV=1
sp|A1XP58|XGEA_ASPNG	4.73e-88	11	244	7	240	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1
sp|B8N3L3|XGEA_ASPFN	4.35e-81	15	244	11	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1
sp|Q2UK93|XGEA_ASPOR	4.35e-81	15	244	11	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xgeA PE=3 SV=1
sp|Q5BG78|XGEA_EMENI	3.19e-78	9	245	4	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999759	CS pos: 22-23. Pr: 0.9603

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_210467-t33_1-p1.