CAZyme Information: ASPCADRAFT_209292-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_209292-t33_1-p1
• CAZy Family: PL4
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	KV907504|CGC5	48096.13	5.5712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907504:185874-187163(-)

Full Sequence      

MPRPRRVTLLASLLALSLLYTLYHHHHRTPSSPPLHAIPLDCPSHPDLSDILVILKTGVT
ESRDKVPIHLTTTLRCIPNHALFSDYVEPLSPTIATHDVLASLSPALIATNPDFDLYRRV
RAAGPSALTPADLNPDINTPIGKPNNPGWKLDKWKFLPMLDEALLLKPDAKWYVFMEADT
YILWDNLLGWLKRFDPREAVYLGNQMQIVDAIFAHGGSGFILSKPAVVRAVEHRKRSSDG
WERAVGEHWAGDCMLGILLEDVGIDLTWAWPMMQIAPPGEMDYFSLGYERRPWCYPAVSF
HHLEAAGIRELDEMERTRTERGEKGPVLYRDVFLELMRPGLRDVRPDWDNRVEGEPVSVP
SFAACRGVCSREALCLQYAYNETAGECRTSQVLALGQAQPGGGLSAGWMTERIDAMAESL
GECDEISWI

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_209292-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.57e-05	168	332	209	377	hypothetical protein; Provisional
367085	Fringe	1.65e-04	166	267	81	196	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL00916.1|GT31	6.15e-245	1	429	1	421
BCS14707.1|GT31	1.76e-244	1	429	1	421
BCS03059.1|GT31	1.76e-244	1	429	1	421
QMW40773.1|GT31	5.17e-155	2	429	10	437
BAE58433.1|GT31	1.47e-154	41	429	53	437

PDB Hits     

ASPCADRAFT_209292-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0VC84|C1GLT_BOVIN	1.69e-09	169	357	161	363	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9NS00|C1GLT_HUMAN	6.94e-09	169	312	161	320	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q9JJ05|C1GLT_RAT	2.91e-08	169	312	161	320	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
sp|Q7SYI5|C1GTB_DANRE	7.15e-08	134	312	126	319	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B OS=Danio rerio OX=7955 GN=c1galt1b PE=2 SV=1
sp|Q5F3G7|C1GLT_CHICK	2.18e-07	169	254	162	248	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998520	0.001506

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_209292-t33_1-p1.