CAZyme Information: ASPCADRAFT_208217-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_208217-t33_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753		82958.68	6.2413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907501:338586-340847(+)

Full Sequence      

MGESKCPFHPRGSNANIGGGGTRNTDWWPDQLRLDILRQHASASNPLAPDFDYTAAFNSL
DYYAVKKDLTDLMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRVFDGRGGGGQGQQRFAP
LNSWPDNASLDKARRLLWPIKQKYGAKISWADLMLLAGNVALESMGFKTFGFSGGRADTW
EADESVYWGGERTWMGNDIRYADGFPGVTKHGAIDTDEPPHLNIHTRELEKPLAASHMGL
IYVNPEGPDGNPDPLAAARDIRTTFGRMGMNDEETVALIAGGHSFGKTHGAAPSDKVDAE
PAAADLDAQGLGWNNNYESGKGRHAITSGLEVTWTKTPTKWSHGFLEYLFRFDWELTKSP
AGANQWQAKGADDIIPDAYDSAKRHKPKMLTTDLSLRYDPIYEKISRRFLEHPDQFADAF
ARAWFKLLHRDMGPRTRYIGPEAPTENLLWQDPIPAVDHPLVDAADIANLKRTILDTGVE
GSKFVSTAWASASTFRGTDKRGGANGARIRLAPQRQWEVNNQPWLTETLSILEAIQKDFN
SASSAGKKISLADLIVLAGCAAVEKAAQDAGHAISVPFTPGRMDASQEQTDVQSAAHLEP
VADGFRNYGRSTARVRAEKYLVDKAHLLTLTAPEMTVLVGGLRVLNTNYDGSAHGVFTAT
PGRLTNDFFVNLLDMRTAWKAKDGDRDVYEGTDRTTGATKWTATRADLVFGSHAELRAVA
EVYGSADGQEKFVQDFVAAWNKVMNLDRFDLKA

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173824	catalase_peroxidase_1	0.0	19	448	1	409	N-terminal catalytic domain of catalase-peroxidases. This is a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Catalase-peroxidases can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. These enzymes are found in many archaeal and bacterial organisms, where they neutralize potentially lethal hydrogen peroxide molecules generated during photosynthesis or stationary phase. Along with related intracellular fungal and plant peroxidases, catalase-peroxidases belong to class I of the plant peroxidase superfamily. Unlike the eukaryotic enzymes, they are typically comprised of two homologous domains that probably arose via a single gene duplication event. The heme binding motif is present only in the N-terminal domain; the function of the C-terminal domain is not clear.
173828	catalase_peroxidase_2	0.0	452	748	1	297	C-terminal non-catalytic domain of catalase-peroxidases. This is a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Catalase-peroxidases can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. These enzymes are found in many archaeal and bacterial organisms where they neutralize potentially lethal hydrogen peroxide molecules generated during photosynthesis or stationary phase. Along with related intracellular fungal and plant peroxidases, catalase-peroxidases belong to plant peroxidase superfamily. Unlike the eukaryotic enzymes, they are typically comprised of two homologous domains that probably arose via a single gene duplication event. The heme binding motif is present only in the N-terminal domain; the function of the C-terminal domain is not clear.
223453	KatG	0.0	4	752	16	730	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
237891	PRK15061	0.0	1	752	1	726	catalase/peroxidase.
272957	cat_per_HPI	0.0	4	751	2	713	catalase/peroxidase HPI. As catalase, this enzyme catalyzes the dismutation of two molecules of hydrogen peroxide to dioxygen and two molecules of water. As a peroxidase, it uses hydrogen peroxide to oxidize donor compounds and produce water. KatG from E. coli is a homotetramer with two non-covalently associated iron protoheme IX groups per tetramer, but the ortholog from Synechococcus sp. is a homodimer with one protoheme. Important sites (numbered according to E. coli KatG) include heme ligands His-106 and His-267 and active site Trp-318. Note that the translation PID:g296476 from accession X71420 from Rhodobacter capsulatus B10 contains extensive frameshift differences from the rest of the orthologous family. [Cellular processes, Detoxification]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ91289.1|AA0	0.0	1	751	1	750
UPK95725.1|AA0	0.0	1	751	62	805
UPM44564.1|AA0	3.48e-303	24	752	5	715
UKZ83034.1|AA0	2.78e-302	15	751	62	786
UKZ91589.1|AA0	2.26e-299	5	752	57	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5SYU_A	0.0	3	751	4	727	Crystal structure of Burkholderia pseudomallei KatG E242Q variant [Burkholderia pseudomallei 1710b],5SYU_B Crystal structure of Burkholderia pseudomallei KatG E242Q variant [Burkholderia pseudomallei 1710b]
5SYY_A	0.0	3	751	4	727	Crystal structure of the S324G variant of catalase-peroxidase from B. pseudomallei [Burkholderia pseudomallei 1710b],5SYY_B Crystal structure of the S324G variant of catalase-peroxidase from B. pseudomallei [Burkholderia pseudomallei 1710b]
5SYW_A	0.0	3	751	4	727	Crystal structure of Burkhoderia pseudomallei KatG variant Q233E [Burkholderia pseudomallei 1710b],5SYW_B Crystal structure of Burkhoderia pseudomallei KatG variant Q233E [Burkholderia pseudomallei 1710b]
5SYV_A	0.0	3	751	4	727	Crystal structure of Burkholderia pseudomallei KatG N240D variant [Burkholderia pseudomallei 1710b],5SYV_B Crystal structure of Burkholderia pseudomallei KatG N240D variant [Burkholderia pseudomallei 1710b]
5V53_A	0.0	3	751	4	727	Crystal structure of the D141A/Q233E/N240D variant of catalase-peroxidase from B. pseudomallei with acetate bound [Burkholderia pseudomallei 1710b],5V53_B Crystal structure of the D141A/Q233E/N240D variant of catalase-peroxidase from B. pseudomallei with acetate bound [Burkholderia pseudomallei 1710b]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8X1N3|KATG_BLUHO	0.0	1	751	1	728	Catalase-peroxidase OS=Blumeria hordei OX=2867405 GN=katG PE=3 SV=2
sp|A1DAL6|KATG_NEOFI	0.0	1	752	1	750	Catalase-peroxidase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=katG PE=3 SV=1
sp|A1C8R3|KATG_ASPCL	0.0	1	752	1	751	Catalase-peroxidase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=katG PE=3 SV=1
sp|Q96VT4|KATG_EMENI	0.0	1	752	1	727	Catalase-peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=katG PE=1 SV=1
sp|A1V0A6|KATG_BURMS	0.0	3	751	4	727	Catalase-peroxidase OS=Burkholderia mallei (strain SAVP1) OX=320388 GN=katG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_208217-t33_1-p1.