CAZyme Information: ASPCADRAFT_207800-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_207800-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: carbohydrate-binding module family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		55849.44	3.9763

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907500:952691-954289(+)

Full Sequence      

MSSFHVYRAALLLSILATSQAQQVGTYQTETHPSLTWQTCTSSGCTTNDGEVVIDANWRW
VHETGGYTNCYTGNSWDTSICPDDETCAENCALEGASYSSTYGVTTSGDELRLNFVTTSS
SKNIGSRLYLMSDDSNYELFKLLNQEFTFDVDVSNLPCGLNGALYFVAMDADGGTSKYSG
NKAGAKYGTGYCDSQCPRDLKFIDGEANSDGWVPSTNNVNTGVGDHGSCCAEMDIWEANS
ISTAFTAHPCDTPGQVMCDGDGCGGTYSSTSDRYGGTCDPDGCDFNTYRLGNTSFYGPGL
TVDTSSPFTVVTQFITDDGTSSGTLSEIRRLYVQNGKVIANGESTYASASGNSITSSFCD
AEKTLFGDENVFDTHGGLEGMSAAMAQGMVLVLSLWDDYAADMLWLDSNYPTNKSSTTPG
VARGTCSVDSGVPADVEAESPNAYVTYSNIKVGPLGSTYSGGSGSSSSSGSSTTTAKSTS
TTSKATSTTTSGSSTSVASAYAQCGGQGWTGATQCASGYTCTYQNAYYSQCL

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	23	459	1.9e-194	0.9951807228915662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
153432	GH7_CBH_EG	0.0	30	453	2	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395677	Glyco_hydro_7	0.0	24	455	1	431	Glycosyl hydrolase family 7.
395595	CBM_1	5.98e-13	500	528	1	29	Fungal cellulose binding domain.
197593	fCBD	2.62e-12	500	532	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44068.1|CBM1|GH7|3.2.1.176	1.07e-317	1	532	1	536
AAF04492.1|CBM1|GH7|3.2.1.176	1.07e-317	1	532	1	536
AKH61141.1|CBM1|GH7	2.13e-317	1	532	1	536
AAP66264.1|CBM1|GH7|3.2.1.176	5.33e-317	1	532	1	536
QEQ56122.1|CBM1|GH7	6.19e-316	1	532	1	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V1Z_A	1.75e-269	23	462	2	440	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
1Q9H_A	3.61e-247	23	460	2	435	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
4ZZT_A	1.68e-224	23	461	2	437	Geotrichum candidum Cel7A structure complex with thio-linked cellotriose at 1.56A [Geotrichum candidum],4ZZU_A Geotrichum candidum Cel7A structure complex with thio-linked cellotetraose at 1.4A [Geotrichum candidum],4ZZV_A Geotrichum candidum Cel7A apo structure at 1.4A [Geotrichum candidum],4ZZW_A Geotrichum candidum Cel7A structure complex with cellobiose at 1.5A [Geotrichum candidum],5AMP_A Geotrichum candidum Cel7A apo structure at 2.1A [Geotrichum candidum]
4XEB_A	1.98e-220	23	462	2	436	The structure of P. funicolosum Cel7A [Talaromyces funiculosus]
4ZZP_A	5.14e-219	23	459	2	436	Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum],4ZZP_B Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UVS8|CBHB_ASPNG	1.89e-318	1	532	1	536	1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger OX=5061 GN=cbhB PE=2 SV=1
sp|A2QAI7|CBHB_ASPNC	1.89e-318	1	532	1	536	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhB PE=3 SV=1
sp|B0Y8K2|CBHB_ASPFC	3.71e-286	3	532	7	532	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhB PE=3 SV=1
sp|Q4WM08|CBHB_ASPFU	3.71e-286	3	532	7	532	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhB PE=1 SV=1
sp|A1DNL0|CBHB_NEOFI	5.13e-281	3	532	7	530	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000240	0.999739	CS pos: 21-22. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_207800-t33_1-p1.