CAZyme Information: ASPCADRAFT_207673-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_207673-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	KV907500|CGC3	81905.32	8.5923

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907500:528696-531048(-)

Full Sequence      

MAELTVHYVPRDVALPPISSTPVFTDQQWTTLMALADTVIPSIRSPTAYKSASTKVIPHS
DLNRTLSTLSGSIASPDAATIAIQYLEEDASSNPRFREGLERLFSQYVHEEGRNGLGFIL
NALNTRAGSLVLTGSVTPIQDQPIYIREEIFRGWETSRLSPLRAVYRALTGVFKRTWVTF
SPTLCPVIGFPRVPVHGKLANGFRYSFLQFPSSDEPEIMETDVVIVGSGCGGSVAAKNLA
EAGHKVLVVEKAYHYTSDHFPMNFNEGFVSMFEGGGAVATDDGSLAVLAGSTWGGGGTVN
WSASLQTQGFVREEWAKNGLPFFTSGDFQKCMDRVSERMGVDTAHIKHNKANRFLLEGAR
KLGYSAKTVPQNTGHGEHYCGYCTLGCHSTGKKGPTETFLADAATAGATFIEGFRADKVL
FTDTKDGQVASGVEGVWKSRDSYLGRTGVTAIRRKLIIKAKRVVISCGTLQSPLLLLRSG
LKNPHIGRNLHLHPVAIAGVVLDEEIRPWEGAALTTVVNEFENLDGHGHGVKIEALSMLP
AAFLPIFPWRSGLDYKMWVHKLPRTAGLIMLARDRGSGRVYPDPVDGRCRIDYTVSAFDR
KHIAEALVASAKMAFVSGAKEFHTTWREMPPFIRPETSDAEDPEGANNAALQAWIAEVRR
KRPLDPERTMFASAHQMGTCRMGKSPRTSVVDSDCQVWGTRGLYVVDASVFPSASGVNPM
ITNMAIADWASRNLARSLRKDSDKAVLARL

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_207673-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	218	742	1.4e-53	0.5145631067961165

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	4.46e-59	271	495	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	8.31e-39	219	746	6	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.54e-34	574	727	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	1.05e-12	221	731	1	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.43e-10	219	737	4	540	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	3.88e-189	1	738	1	734
QRD90948.1|AA3_1|AA8	8.18e-15	222	734	305	854
BAE61169.1|AA3_1|AA8	3.06e-14	222	734	255	786
QMW43910.1|AA3_1|AA8	9.63e-14	222	734	309	840
QMW31885.1|AA3_1|AA8	9.63e-14	222	734	309	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NAA_A	1.46e-10	222	734	4	534	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	1.47e-10	222	734	9	539	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI7_A	2.26e-09	216	746	225	772	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
3LJP_A	6.49e-08	409	739	225	530	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	8.55e-08	409	739	225	530	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.60e-97	91	742	70	750	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q94BP3|FAO4B_ARATH	1.94e-88	82	739	53	743	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|O65709|FAO4A_ARATH	1.71e-87	102	740	46	724	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	7.17e-86	219	738	231	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|B5WWZ8|FAO1_LOTJA	1.48e-85	219	741	235	747	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_207673-t33_1-p1.