CAZyme Information: ASPCADRAFT_207666-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_207666-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	KV907500|CGC9	54209.27	5.1193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907500:507567-509006(+)

Full Sequence      

MSPPLNRRSWRQSRASVLIFAAAFFSAGFIVFFYSRPSQVAPIPESDPSHSLAPSLDDTN
PCYVDLDRLRQYSISSTTVEYARLEIAVAPTENFTGYTDTLGARFPKFSPVRLDTEERRQ
GLSPDRCTASVTIEGPVPSAQPDASHIIFGIATSVDRLIDSLDAFAHWAAGSNARILAVV
DSGGPGKKEAQKRAEALGIRPTILQEEDERLDRYFYLIRYLYQNKDKSTQWVVMMDDDTF
FPSMTRLVDRLATYDAQKPQYIGAVTEDLQQLYSSGYMAYGGAGIFLSIPLLTDLQPWFD
DCYAFKAGGDRMLSQCIYAHTNTKLSWERDLFQLDLRGDASGFYEAGRVQPLSVHHWKSW
FQADMVALSKVASICGDECLLHRWLLPDEWYLVNGFSVIKYSTISDDPLAMEQTWNASKY
TGPDPFTFSLGPLRRKDEKKISFRLKDAVQEKERVRQIYVNDVTPEKVEVLEVVWNFAA

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.56e-13	230	356	212	341	hypothetical protein; Provisional
398362	DUF604	5.34e-10	270	356	1	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	5.39e-06	231	298	87	162	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96058.1|GT31	1.74e-296	1	479	2	477
BCS08579.1|GT31	1.74e-296	1	479	2	477
CAK44001.1|GT31	1.04e-294	1	473	1	470
QRD89155.1|GT31	3.67e-193	10	476	10	468
BAE54694.1|GT31	3.67e-193	10	476	10	468

PDB Hits     

ASPCADRAFT_207666-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPCADRAFT_207666-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000004

TMHMM  Annotations     

Start	End
13	35