CAZyme Information: ASPCADRAFT_207178-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_207178-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	KV907499|CGC9	39388.22	5.2206

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907499:660656-661735(+)

Full Sequence      

MLLSNLKSSRYGRFAALTIPVVVLLCLLAFTWDPLPGPLPRPPTPQQTPASAQPPHDASR
NSIPTSRPVSAAPAGDVVGGAISGITDKIWQSAKNPHLSDDQHDWIDTWFTTNPSFRYEL
LTDASAVTFVRTHYAMRPDIIEVFETLPIPILRADLLRYLLVLAEGGIWSDLDVTCDKPV
AEWVPPEYKDDRIEMIVGLEFDFEWRGEGTPIASQFCNWVFAAPPSSRVLQVVVDAVVAK
IKEIAALNRVPIKALTLEMLPIDVVDVTGPKIMTIAVLESLRQLLGRTVDDRDFHAIKKP
KLIGDVLIMPGVSFAAAQNGYPDDQGDALVTHHYAGSWKAADAEAKEKKKQTQNGGQSA

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_207178-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	104	185	3.2e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.98e-18	85	339	82	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.00e-13	106	188	8	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46331.1|GT32	6.97e-193	1	355	52	416
BCS14453.1|GT32	2.04e-192	1	355	1	368
BCS02801.1|GT32	6.95e-192	1	355	35	402
QKX62870.1|GT32	2.68e-129	1	353	1	378
QQK48128.1|GT32	6.90e-125	81	350	82	351

PDB Hits     

ASPCADRAFT_207178-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.68e-26	85	339	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.89e-24	89	339	134	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	8.10e-21	108	339	126	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.85e-14	85	231	96	276	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000002

TMHMM  Annotations     

Start	End
13	32