CAZyme Information: ASPCADRAFT_205493-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_205493-t33_1-p1
• CAZy Family: GT8
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		53260.43	5.6450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907496:1901664-1903067(+)

Full Sequence      

MGKRKLLRFVVVGCLVTTFTIFLWPQAEPPRVTTQTVSNITLTSDVDCQPDFEALHRLDI
QKLAQYVRREVVTVQSPTNVLPLSQRLHVPLFPEKSQDDQHRLSEEPLHDDCLIPQQVSV
QVPPPPKRADASHIDFGVATTLERLNDSLDAFSHWASHNNAHIFALIEPDERAHEVLLKA
NALGINLSVEESSEEYQRRYFSLVPHLAKNMRPETRWSCVMDDDTFFLSMPELLKGLSEY
DDTKPMYVGGLSESIPQVGVFGLMGFGGAGVFLTRPLIQELSRPEIFDDCQRMDVTGDRR
ISLCIYQYTSVRLTIDHRLHQLDMMGDVSGFFEAERPPPLSVHHWKSWFHADMAKASLVS
NICGDSCLLRQWHFGDGWILTNGFSVVKYSTEKKPGDRSMELTWDSHNGAVFESYLHELG
PLRVKDEGKISYLHEDALVDGDRVRQWYVHRDPEKGDQVLEVIWRAG

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_205493-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	3.14e-13	213	344	209	341	hypothetical protein; Provisional
367085	Fringe	7.52e-10	132	348	4	231	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	9.89e-09	264	344	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96997.1|GT31	2.04e-313	2	466	14	478
BCS09474.1|GT31	2.04e-313	2	466	14	478
CAK44690.1|GT31	3.75e-300	1	448	1	448
BAE58287.1|GT31	9.18e-249	3	466	19	484
UDD56605.1|GT31	9.18e-249	3	466	19	484

PDB Hits     

ASPCADRAFT_205493-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPCADRAFT_205493-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.741301	0.258695

TMHMM  Annotations     

Start	End
7	24