CAZyme Information: ASPCADRAFT_205336-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_205336-t33_1-p1
• CAZy Family: GH18
• CAZyme Description: glycosyltransferase family 69 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		51323.76	5.5969

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907496:1317331-1318707(-)

Full Sequence      

MYPNSLPMNFNVRQVQGHLFRLTVSTACLCLSVFLYVSVDWSAPQLSASLDLSNPGYDPD
AIVPAISTCNGFNPAPVAEALDETLTAKLPINGSAVDDFVCSIMTHNMSLTAKLDCPTEI
SPRYADLPIKPSSRAISNPKVKYFFALDLYQATHILLPLMGTIIETMRFLGPEYCALSIV
EGRSTDGTYDVLDRLKSELAAMGVRYYLSTNDLNPKAVWEDRIKHLSTLRNQALSPLTSA
GVGKFSPYAADTTILFINDIVLCVEDLLELLYQHQLQHAKMTCAFDWNAGGGSFYDSWVS
RSMSGNLFFEITHDAKYWLTQDMFFDDTPSQERYARHLPLQVYACWGGMVILDAAPFVQR
KLEFRNHRDGECHMGEPTLLAKDMWGQGLGKILAVPAVNVAYEYKATREAKKGRGYVHDR
ITSGNYKPDMELIEWNDEPPAKIKCMPLFNKQSWVEST

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_205336-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	142	385	2.5e-77	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	2.36e-90	142	380	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01113.1|GT69	1.00e-276	8	458	1	450
BCS12865.1|GT69	1.00e-276	8	458	1	450
CAK38727.1|GT69	7.74e-263	8	458	1	452
BAE64674.1|GT69	9.06e-163	1	455	1	444
UDD63923.1|GT69	2.75e-162	1	455	13	456

PDB Hits     

ASPCADRAFT_205336-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	2.61e-41	127	447	119	443	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000005

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_205336-t33_1-p1.