CAZyme Information: ASPCADRAFT_203503-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_203503-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: carbohydrate esterase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
150	KV907494|CGC22	17009.85	5.0357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907494:1342884-1343336(+)

Full Sequence      

MDTLFSSVQTIYSLGYRSYLFMNLPPLDRRPGNLGSADPSPNATQITWYNDALAQHADAF
HGRYSDTNVILFDAHSELSYILDHPSQYGIVNTTNFCAGYDQPDIEWNYKAYGCPTPLST
YFWYNSGHMTSHIHKILASAVLEKLEEWSG

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_203503-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	1	141	4.5e-46	0.4794007490636704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.61e-36	1	143	130	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	8.13e-15	1	144	163	314	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	3.10e-10	6	146	198	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	3.61e-05	57	142	183	278	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK37535.1|CE0	7.21e-96	1	149	170	318
BCS08972.1|CE0	4.24e-87	1	141	192	332
BCR96460.1|CE0	4.24e-87	1	141	192	332
BAE65038.1|CE0	1.79e-71	1	146	116	261
QRD91661.1|CE0	1.71e-70	1	146	191	336

PDB Hits     

ASPCADRAFT_203503-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPCADRAFT_203503-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000030

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_203503-t33_1-p1.