CAZyme Information: ASPCADRAFT_202201-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_202201-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: glycoside hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	KV907493|CGC13	48684.79	4.1651

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907493:206996-208452(+)

Full Sequence      

MVRLTYLAAATLAGTATAIDLDITNQDSIKNAAATAAFNTMSYYTGNQTGQIPGYINSSW
WEGGALFDTMIRYWHFTGDASNNPAVSQGLYFQRGNNNYMPSNWSSYMGNDDQMAWGLAA
MTAAELAFPQGTDMPSWVSLAERVFDMQAARWDTSTCAGGLRWQIWPYEAGYTYKNAVSN
GGLFQLAARLARFTNNQTYSDWAEKVWDWSVSYLIDEEKWMVADSTQTDSNCSTVGDNQW
TYNYATYLSGAAYMYNYTNGETAKWKTGLDGLLNTTFSTFFPEKYGGMIMSEVLCEPSQV
CNDAEITYKGLLAGDLTFVSVVAPYTASEILPRLQGSAAGAAKQCSGGDSGTVCGVRWYQ
STWDGWSGFEEEMSATSIFTSNLVAYKNQSPVTQATATNQTVSANGTVSGNGTTTGNSAS
SSSSGVVKNGASALAYGPFGVIAAIVAVAAIA

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_202201-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	25	392	2.8e-96	0.9608938547486033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.71e-163	28	375	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	8.43e-04	159	248	134	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44952.1|GH76	2.86e-232	1	447	1	451
BCS13375.1|GH76	1.09e-222	1	447	1	451
BCS01664.1|GH76	1.09e-222	1	447	1	451
BCS03764.1|GH76	1.16e-173	19	399	23	404
BCS15380.1|GH76	1.16e-173	19	399	23	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	8.86e-87	23	400	30	419	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	2.36e-92	16	375	17	376	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	5.76e-92	18	393	21	394	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.86e-91	23	399	24	394	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	9.21e-90	19	399	19	397	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	4.33e-89	6	396	6	400	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000366	0.999607	CS pos: 18-19. Pr: 0.9694

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_202201-t33_1-p1.