CAZyme Information: ASPCADRAFT_179954-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_179954-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278	KV907623|CGC1	30799.37	7.2446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907623:4289-5178(-)

Full Sequence      

MKQAGSVLALAGLISLAQGHGFVTSPQARMPGSAMEAACGTQVYNNQEADNYGNVQGELQ
IASGQSDYDASACDIWLCKGYKYADNKDNVYSYTAGETVDFVVDIRAPHTGTANVSVVET
STNTVIGSPLIYWSVYASTATGVTKNETNFSVTIPEDLGDKCTEGGACVLQWWWNAASID
QTYESCIDFTVVLFVFVFHLGHQHRRCHGAYHHHCRCCHHPRHGQQHRSRFLQRPHHPGH
QREGECHHRCCCCLQQRLGLDCVHPHRRYRRGAAHLGG

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_179954-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	20	189	3.5e-73	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.75e-07	20	188	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK37296.1|AA16	8.70e-129	1	191	1	191
BCS05968.1|AA16	1.08e-127	1	191	1	191
BCR93324.1|AA16	1.08e-127	1	191	1	191
QLE11222.1|AA16	1.84e-102	1	191	1	191
CAF32158.1|AA16	1.84e-102	1	191	1	191

PDB Hits     

ASPCADRAFT_179954-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPCADRAFT_179954-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000413	0.999543	CS pos: 19-20. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_179954-t33_1-p1.