CAZyme Information: ASPCADRAFT_176233-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_176233-t33_1-p1
• CAZy Family: GH125
• CAZyme Description: polysaccharide lyase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		38983.50	4.1490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907509:72424-73770(+)

Full Sequence      

MKYAAALTAVAALAARAAAVGVSGTPEGFASSATGGGSATAVYPTTTDELVSYLGDDEAR
VIVLTKTFDFTDSEGTTTTTGCAPWGTASNCQLAINQDDWCTNYEPDAPTSSVTYDNAGT
LGITVNSNKSLIGEGTSGVIKGKGLRMVSGVSNIIIQNIAVTDINAKYVWGGDAITLDDA
DLVWIDHVTTARIGRQHYVLGTEADNRVSITNNYIDGESDYSATCDGHHYWNVYLDGSSD
KVTFKGNYLYKTSGRAPKVQDNTYLHIVNNYWENNSGHAFEIGSGGYVLAEGNYFSNVDT
VLETDTFKGVLFSASSASSTCESYIGRACVANVNEGDLSGTSTTALEAFNGDTLATADAA
STSPASSAGQGNL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	113	297	1.1e-92	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.15e-58	112	299	3	190	Amb_all domain.
366158	Pec_lyase_C	4.84e-15	123	295	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	8.97e-15	123	297	97	275	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
GAA92866.1|PL1_4|4.2.2.10	4.01e-242	1	373	1	373
BCR99717.1|PL1_4	4.01e-242	1	373	1	373
CAK47350.1|PL1_4|4.2.2.10	3.84e-240	1	373	1	373
AAA32701.1|PL1_4|4.2.2.10	5.45e-240	1	373	1	373
CAP80630.1|PL1_4	4.02e-219	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.68e-182	20	373	1	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.20e-178	20	373	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	8.46e-160	21	357	2	341	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RBL2|PELD_ASPNC	6.82e-241	1	373	1	373	Probable pectin lyase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelD PE=3 SV=1
sp|P22864|PELD_ASPNG	9.69e-241	1	373	1	373	Pectin lyase D OS=Aspergillus niger OX=5061 GN=pelD PE=1 SV=1
sp|Q2TXS4|PELD_ASPOR	1.91e-213	1	373	1	375	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|B8NVB7|PELD_ASPFN	1.91e-213	1	373	1	375	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|B0YCL3|PELB_ASPFC	4.29e-203	1	373	1	375	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000310	0.999672	CS pos: 19-20. Pr: 0.5848

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_176233-t33_1-p1.