CAZyme Information: ASPCADRAFT_175801-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_175801-t33_1-p1
• CAZy Family: GH12
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839	KV907508|CGC2	92228.67	5.5821

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907508:406282-408971(-)

Full Sequence      

MTRLDVEKTIEELTLGEKVALTAGVDFWHTAAIPRLNIPALRMSDGPNGVRGTRFFNGVP
AACFPCATALGATWDAQLLHEVGQLMGEESIAKGSHIVLGPTINTQRSPLGGRGFESFAE
DGVLSGTLAGNFCKGLQAKGVAATLKHFVCNDQEHERMAVDSIVTPRALREIYLLPFQLA
MRICPTACVMTAYNKVNGTHVSENKAIITDILRKEWKWDGLVMSDWFGTYSTSDAIEAGL
DLEMPGKTRWRGTALAHAVSSNKVPEFVLDERVRNILNLINWVEPLCIPDNAVEKALNRA
QDQALLRRAAAESVVLMKNEDNRLPLSKDKSVLIIGPNAKIAAYCGGGSASLDPYYTVSP
YDGIAAKTNASIDFSQGVYSHNDLPLLGPLLKTADNKPGFTFRVYNEPPSHSSRTLVDEL
HLLRSTGFLMDYINPKINSLTYYIDMEGYFTPTESGIYDFGVTVVGTGRLLIDDELIVDN
TRNQRQGSAFFGTATVEERGSKQLNANQTYKVVFEFGTAPTSDLDTRGIVVFGAGGFRFG
AARQTTQEDLISTAVAQARTANQVVVFAGLTSEWETEGHDRENMELPPGTDEMISRVLDA
NPNTIVVLQSGTPVTMPWVHKAKALLHAWFGGNECGNGIADILYGDVNPSAKLPVSFPVR
LQDNPSYLNFRSERGRVLYGEDIYVGYRYYEKVNLAPLFPFGHGLSYTTFSRSNLTLTTS
PEQPTLSDGEPITATITVKNTGPIPGAEVIQLWVLPPAVTGVNRPVRELKGFTKVFLHPG
EEKKVEIVVEKKLATSWWDEQREKWVSEKGDYGVLVTGTGEGELRDQFKVERTRYWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	245	3e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.98e-79	35	816	101	750	beta-glucosidase BglX.
224389	BglX	1.19e-75	26	367	48	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.92e-55	314	687	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.43e-45	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.01e-35	13	790	60	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS04055.1|GH3	0.0	1	839	1	839
BCS15658.1|GH3	0.0	1	839	1	839
QEV81509.1|GH3	0.0	23	839	2	818
CAK97412.1|GH3	0.0	23	839	2	818
QMW44618.1|GH3	0.0	1	839	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.44e-267	1	839	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.24e-261	2	839	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.28e-152	4	816	3	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.89e-116	9	824	8	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.11e-107	10	825	58	821	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	0.0	1	839	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	839	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q5AV15|BGLJ_EMENI	0.0	22	839	51	850	Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglJ PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	1	839	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|A1DNN8|BGLJ_NEOFI	0.0	6	839	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995220	0.004796

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_175801-t33_1-p1.