CAZyme Information: ASPCADRAFT_174870-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_174870-t33_1-p1
• CAZy Family: GH12
• CAZyme Description: carbohydrate esterase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		39600.37	6.1116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907506:883771-885020(-)

Full Sequence      

MRPFHFILLLGLEATLAHAHQKWGPSKFTSLVTFGDSYTDDTRINYFINHNGSAPPVGWV
EPITNSSASGGYIWGHYVKEYASLSHRYNYAVSGASCSNHITPRTTSFGLFPSVLEYQVP
AFTSDAAYTLPTTNEPFLSLPPNETIYAIWIGTNDLGNYAFLTDSQVPGKTIPDYIDCVY
DALDGVYATGKAKYFVIMNVVPLELAPLYATPEKGGIGPNNYWPDKGGNFTGISYRMWEQ
VATVNEVYKWRTQVEWGVGVGGRYKGSKVAVMDVHGLILDIYNNPTRYLNGSAPANVTGY
DHHCNVAGTECYRLSSPDSFLWYDQLHPSQRTDQIIAEEFVKVVRGESRWATYWG

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_174870-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	31	340	8.1e-71	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.64e-48	30	341	1	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	8.44e-13	89	340	79	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	7.15e-12	8	338	8	327	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	1.50e-08	31	340	1	224	GDSL-like Lipase/Acylhydrolase.
238883	Triacylglycerol_lipase_like	6.28e-05	28	338	1	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15697.1|CE16	5.17e-206	7	354	9	354
BCS04097.1|CE16	5.17e-206	7	354	9	354
QMW44554.1|CE16	2.64e-149	4	354	2	353
QRD84022.1|CE16	2.64e-149	4	354	2	353
BAE62044.1|CE16	2.64e-149	4	354	2	353

PDB Hits     

ASPCADRAFT_174870-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	2.50e-79	28	354	27	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|Q94CH5|EXL5_ARATH	4.58e-06	28	345	27	354	GDSL esterase/lipase EXL5 OS=Arabidopsis thaliana OX=3702 GN=EXL5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999746	CS pos: 19-20. Pr: 0.9564

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_174870-t33_1-p1.