CAZyme Information: ASPCADRAFT_168543-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_168543-t33_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	KV907499|CGC6	53654.48	7.7704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907499:651845-653320(+)

Full Sequence      

MLLPLRISAAAKRALTQLTHILKLRASRIFVPSLLLWLLLYAYCRTRFWRDPHSAFFQDD
HVYDLDYSLYRERESMHFLARHNAPTSPPENEFYYSYAKNTSETENKPPAVCIAIVTVHR
RQDTYFDASVGSLLKGLTEQERRAMYLTVLFADTDPMVHPSWGQKWVERLLDQARGYNVS
AEQLEDLKMWEAERNFYKKGVFDYLYALRACQAVNAPYTLVFEDDIILATGWFARTLKSL
AEINRREAGPDQDYSHAGEKRKPWLYLRLFYTETLLGWSNADFAYRNMPLIFLTLTASSF
TVLHFLRRYHRFQRLHLDSLSILVISLFCIPAFTGLAYMMGKYNLMPLRGVVEMNKFGCC
TQGLLFPAQQLGGLMGFLENRGHGQTDSLIEEYADLKGLNRYAVAPPLLQHVGLKSSREN
TDINTQSTWQFWFENNEPEALRREHAKLLGDADVQRMLEAAAT

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_168543-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT109	26	448	1.5e-140	0.9708029197080292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409190	PGAP4-like_fungal	1.94e-173	43	420	18	375	uncharacterized fungal proteins similar to Post-GPI attachment to proteins factor 4. This subfamily contains uncharacterized fungal proteins with similarity to animal post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. Proteins from this subfamily contain the putative catalytic site of PGAP4 and may have similar activities.
409189	PGAP4-like	6.79e-51	41	417	12	361	Post-GPI attachment to proteins factor 4 and similar proteins. This family includes post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. This family also includes uncharacterized fungal proteins with similarity to PGAP4.
409191	PGAP4	2.14e-24	48	417	21	376	Post-GPI attachment to proteins factor 4. Post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246), has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases (GTs), it contains three transmembrane domains. Structural modeling suggests that PGAP4 adopts a GT-A fold split by an insertion of tandem transmembrane domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46547.1|GT109	3.46e-205	2	458	1	435
BCR99311.1|GT109	3.79e-202	2	458	1	435
BCS11615.1|GT109	3.79e-202	2	458	1	435
QGA19659.1|GT109	6.62e-148	18	445	16	420
QMW36896.1|GT109	2.44e-117	109	458	3	339

PDB Hits     

ASPCADRAFT_168543-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5EB73|PGAP4_RAT	8.64e-07	109	417	100	393	Post-GPI attachment to proteins factor 4 OS=Rattus norvegicus OX=10116 GN=Pgap4 PE=2 SV=1
sp|Q91YV9|PGAP4_MOUSE	8.64e-07	109	417	100	393	Post-GPI attachment to proteins factor 4 OS=Mus musculus OX=10090 GN=Pgap4 PE=2 SV=1
sp|Q5R868|PGAP4_PONAB	3.55e-06	109	417	100	393	Post-GPI attachment to proteins factor 4 OS=Pongo abelii OX=9601 GN=PGAP4 PE=2 SV=1
sp|Q9BRR3|PGAP4_HUMAN	8.26e-06	109	417	100	393	Post-GPI attachment to proteins factor 4 OS=Homo sapiens OX=9606 GN=PGAP4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000010

TMHMM  Annotations     

Start	End
284	306
319	341