CAZyme Information: ASPCADRAFT_156301-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_156301-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	KV907515|CGC3	44740.57	4.8450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907515:82439-83626(+)

Full Sequence      

MQMKTPLPGVCLPRHVRRVVPLFLAVFCLVFYLSITGTFGELRGLSRAPSQCKLFPRKIW
QSWKVNPFEFEERDLTVARSWTSTNPGYRYEVLTDQNDLHYVETNFGPDGFNRPDIVDTY
RALTAKIIKADLLRYLVMYVDGGVYADIDVEALRPLERFIPERFHEEDMDLIIGVEIDEP
DFNDHAILGQKSQSFCQWTFISKPRQPVMMRLVDHILEWLHDHSVKQGKPISELELDFDD
IISGTGPSAFTGAVLAEMSYRTGQEVTWKTFHDIPESKLVGGILVLTVEAFAAGQGHSDS
GNHNARSALVKHHYHASGWPNNHPRYNHPVYGEVEQCNWNKQCVAEWDANTAAFAAMSPE
EQAQQIAMKQASDAEAAELAALDEMDDLDLGLSIE

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_156301-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	77	161	5.7e-20	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.58e-24	53	244	80	276	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.08e-14	72	162	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96510.1|GT32	1.25e-257	1	395	1	408
BCS17076.1|GT32	2.23e-257	1	395	10	414
BCS05523.1|GT32	9.27e-256	1	395	111	515
QMW40889.1|GT32	1.27e-225	9	376	3	372
BAE58544.1|GT32	1.27e-225	9	376	3	372

PDB Hits     

ASPCADRAFT_156301-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.97e-36	56	319	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.01e-31	55	291	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	6.64e-30	51	312	95	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.17e-21	56	234	97	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.40e-09	50	160	52	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000003

TMHMM  Annotations     

Start	End
20	39