CAZyme Information: ASPCADRAFT_147655-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_147655-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	KV907500|CGC4	54242.84	4.9100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907500:1233248-1234917(-)

Full Sequence      

MGSVTTSTLPPDFLWGFATASYQIEGAVNEDGRGPSIWDTFCKIPGKIAGGANGDIACGS
YHRTAEDIALLKECGAQAYRFSISWSRVIPLGGRKDPVNEKGLQHYVKFVDDLLAAGITP
LVTLFHWDLPDELDKRYGGLLNKDEFVADFANYARVIFRALGPKVKHWITFNEPWCSSVL
GYNVGQFAPGRTSDRSKSAEGDSSRECWIVGHNLLVAHGAAVKIYRDEFKAKDGGEIGIT
LNGDWAEPWDPENPADVEACDRKIEFAISWFADPIYHGKYPDSMVKQLGDRLPQWTPEDI
ALVHGSNDFYGMNHYCGNYIKAKTGEPDLNDTAGNLEILQQNKQGEFIGPETQSAWLRPY
ALGFRKLLKWLSDRYNQPKIYVTENGTSLKGENDLPLEQLLKDDFRTQYFRDYIGAMADA
YTLDGVNVRAYMAWSLMDNFEWAEGYETRFGSTYVDYENGQKRIPKNSAKQIGLIFNQYI
EQ

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	473	5.8e-161	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	10	470	1	424	beta-galactosidase.
395176	Glyco_hydro_1	0.0	8	470	4	442	Glycosyl hydrolase family 1.
225343	BglB	9.48e-144	6	469	1	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	2.72e-112	7	469	28	473	beta-glucosidase
215435	PLN02814	7.15e-110	5	469	24	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12207.1|GH1	0.0	1	482	1	482
BCS00431.1|GH1	0.0	1	482	1	482
CAK47813.1|GH1	0.0	1	482	1	482
QEV81508.1|GH1	0.0	1	482	1	482
QRD82378.1|GH1	0.0	1	482	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.50e-281	4	482	21	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	4.43e-247	9	480	3	463	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	4.88e-244	9	480	3	463	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	9.77e-244	9	480	22	482	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	9.85e-241	9	480	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	7.47e-196	9	482	11	477	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.63e-182	4	482	1	462	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	6.38e-145	4	470	28	496	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q339X2|BGL34_ORYSJ	3.11e-144	2	470	31	500	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q9SPP9|RG1_RAUSE	8.17e-144	4	469	17	504	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_147655-t33_1-p1.