CAZyme Information: ASPCADRAFT_141030-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_141030-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: polysaccharide lyase family 4 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	KV907495|CGC9	72713.90	4.5450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907495:2459184-2461305(-)

Full Sequence      

MRQLLSLSLTTLWFTLASATLHTTQNTSTLILSNDRLTAHFSKSQGRITDLYLDSQDLLG
PQSGDTGVGPYLDCYCIPSGFYTPGTTSSTSNSTLRLITGTDTTNTQYAGVVMDSTYFPT
GQHFQQYWFLRDGETGLHTFSRLAYYNASTPYLRNLQEFRTLFRPNTDLWTHLTSSEVQT
APLPSEKAIDEEVVVQDATWTFNNTPGDAYYTQFSDYFTKYTFSNAWRDNSVHGVYADGS
TSNGTTYGAWLVMNTKDTYYGGPLHSDLTVDGIVYNYLVSNHHGEGTPNITYGFDRTFGP
QFYHFNGGKGSASLQELKSDAESLADPSWNLEFYDSIATHVVGYAPSSKRGRVQGQIDLP
KGATRPVAVLTVGGQYFQDNSVNASSYQYWAEIDATGRFNVDHVKEGVYRLTVYADGIFG
DFERDGVQVKAGQTTTVQETWVAESAGTEIWRLGTPDKSSGEFRHGVARDPTHPLHPPEY
LIYWGAYDWQTDFPDGINYTIGTSDPATDLNTVQWSVFGPTPNDPHVEYDTTHDWTINFP
LSEDDLAQRSTATLTIQLAGAKTASGNTDIYSPKELYNNLALESYINDQPEPLTLLIGFN
QSSSCIVRSAVSCYQVRSRMEFPTDWLKVGNNVLTLHLPYNATDTETAILPATV

Enzyme Prediction     

EC	4.2.2.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	18	651	0	0.9984177215189873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	4.44e-56	28	308	8	259	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	6.28e-29	349	437	1	89	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199905	RGL4_C	2.33e-26	451	639	1	144	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	1.14e-24	360	436	1	74	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.
405384	CBM-like	1.31e-17	450	639	2	141	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15831.1|PL4_3	0.0	1	654	1	651
CAK48272.1|PL4_3	0.0	1	654	1	651
BCS04241.1|PL4_3	0.0	1	654	1	651
QMW42683.1|PL4_3	0.0	1	654	1	651
QMW30630.1|PL4_3	0.0	1	654	1	651

PDB Hits     

ASPCADRAFT_141030-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XPA2|RGLB_ASPFC	0.0	1	654	1	646	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rglB PE=3 SV=1
sp|B8N5T6|RGLB_ASPFN	0.0	1	654	1	651	Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rglB PE=3 SV=1
sp|Q0C7K7|RGLB_ASPTN	0.0	1	654	1	648	Probable rhamnogalacturonate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglB PE=3 SV=1
sp|Q4WR79|RGLB_ASPFU	0.0	1	654	1	646	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rglB PE=3 SV=1
sp|Q5AZ85|RGLB_EMENI	0.0	17	654	16	648	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999763	CS pos: 19-20. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_141030-t33_1-p1.