CAZyme Information: ASPCADRAFT_138330-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_138330-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	KV907494|CGC12	57030.80	7.1936

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907494:1089971-1091617(-)

Full Sequence      

MSSRRTSLTPTSSDKMPRVLFLTNSECGKASVILAVAHEFLINSSYKIHIGSFRPLKKQI
AELNYHAASYGSTRNTAVLEEIPGLSIKQIRIRDGQVDDVWDVHKVGLCAALKTYRNVLS
PALLPWMGVEYVSIFDAIVGVVQALTPTLIIVDPSFVPAVDVCRNLRWRHVLLGSDPAQE
HVVQPSLANLLQYPLIGSGFTYPLECWAKLCNVYLGFQLERAVKDSGSFKDVEEARHARG
IEGPIPIPYMHHGKAVNDTIISPGRLETDYPLTMPENITLCGPIVRPYRPIAEEDPEIAH
WLFQRPTVLINMGTRFNYDDKRQIEFGKAVCKLLGAKPDLQVLWKLQRDEGVTVSRELIE
ILQLHIVQQRVRIESWFAFEPMSLLMSSHITCVVHHGGTNVYHEAVRAGVPQVVLPVWFD
TYNFAARVEYLGIGVWGSRKTAPDVSGEELGEALLRVLASDEPNGMREWAQHVSAQLPLK
DGRVVAYEKILEVLGQPWEAPPTRSRTRA

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_138330-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	304	476	1e-20	0.3612565445026178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.78e-26	133	462	88	377	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.39e-10	393	497	304	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	3.89e-05	305	462	225	361	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
215127	PLN02210	2.25e-04	282	448	229	399	UDP-glucosyl transferase
223071	egt	0.002	371	461	348	433	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47643.1|GT1	9.30e-209	13	508	17	510
BCS08887.1|GT1	6.34e-197	17	506	23	510
BCR96374.1|GT1	6.34e-197	17	506	23	510
BCR88350.1|GT1	2.88e-140	16	492	1	483
BCS26405.1|GT1	2.92e-140	19	494	6	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RRV_A	4.08e-10	390	502	303	407	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
2YJN_A	1.62e-07	296	463	258	404	Structure of the glycosyltransferase EryCIII from the erythromycin biosynthetic pathway, in complex with its activating partner, EryCII [Saccharopolyspora erythraea NRRL 2338]
6KQW_A	4.40e-07	305	462	220	356	Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	4.46e-07	305	462	220	356	Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
1IIR_A	4.71e-07	385	435	297	347	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	3.28e-85	17	476	6	460	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	1.89e-73	15	458	4	466	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	1.30e-09	371	471	442	539	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	1.31e-09	393	462	464	531	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|Q9AFC7|GTFD_AMYOR	2.04e-09	390	502	303	407	Devancosaminyl-vancomycin vancosaminetransferase OS=Amycolatopsis orientalis OX=31958 GN=gtfD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_138330-t33_1-p1.