CAZyme Information: ASPCADRAFT_135460-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_135460-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		63263.76	6.5016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907598:684-2510(+)

Full Sequence      

MASINQTWDFIVVGGGPAGCALASRLARSARRPRVLLLEAGPRNDDPSLRVDGQRWQTFM
NGDLNWGYKTTPQKHCNDRQIDYSRGKVLGGSSAINFGVYTIGARDDYNEWAALVGDDLY
CWERMKARFRGLETFNGAIVNSKHTKYANPKACDHGSQGGLKVGYAAEWEQDLPLMMDVF
EQAGFARNPDHNSGDPIGMALVINSSHQGQRVTATDLLKGAPSNLTVITEAPVLKVLLQG
TKAVGVVTRGKTYLASKEVILTPGSLDTPKILMHSGLGPAEQLRQFQIPVVKDVPAVGQG
LRDHFFAPMCFQRSPATNDRNAFFGDQVAMASALEQWNKDGTGPWARHSCQIAAGWLKSD
RLVESAEFKALPSTVQEFLQRDTVPHYEFMTHFPLHLISPEVTQDYSYVCMLVFLMNEQS
SGEVRLQSANPEDPLLFDPKFLSHPFDRRACIEIYRHALEVTKHDAFQKDTVSTLIAPPS
ESDEDILEFWKNTLASSWHMTGMAKMGKPGDVDAVVDSRFRVFGIEKLRVADMSVVPVLT
NNHTQATAYVTGVTCGDVLAAEYGLDGLQPARL

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_135460-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	560	2.7e-148	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.43e-84	5	547	3	519	choline dehydrogenase; Validated
225186	BetA	4.93e-84	1	562	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.08e-58	9	552	2	479	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	5.94e-36	419	552	2	140	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.72e-33	5	552	53	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99292.1|AA3_2	0.0	1	573	1	572
BCS11595.1|AA3_2	0.0	1	573	1	572
CAK46531.1|AA3_2	0.0	1	573	1	572
EAA62931.1|AA3_2	1.45e-271	5	566	4	569
BCS19530.1|AA3_2	2.66e-268	1	565	1	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	2.17e-55	8	563	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	2.74e-52	8	562	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.78e-52	8	562	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	2.70e-48	2	563	1	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.72e-48	2	563	1	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	2.85e-64	4	559	1	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|A0A075TRK9|PATE_PENEN	1.49e-63	5	549	49	614	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	2.87e-63	5	549	48	614	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.48e-60	5	559	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.44e-58	8	569	2	537	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000024

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_135460-t33_1-p1.