CAZyme Information: ASPCADRAFT_134906-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_134906-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: carbohydrate esterase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	KV907514|CGC3	25471.34	4.8086

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907514:419128-419992(+)

Full Sequence      

MFSRTATLLTLNALLGLSKAALTNSTECADIHFMLARGTTEDYPGTTYSMAELVAENTTL
STNYENIIYPAVSETASDSYFIGRAAVGSQVNSYVAACPKSRIVLISYSQGALIVGDALA
GGGGDSTLGNATEPLISDEVSKHISANVYYGNPRHAPYQPYNLGNNTWNVTGKYPRLDYQ
INYLHDRYRHVTADWCNNGDGVCSPSEGSDSLSLHMAYAKDYDPIAAAWILEKLGV

Enzyme Prediction     

No EC number prediction in ASPCADRAFT_134906-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	234	2.1e-39	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.75e-22	28	234	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK49022.1|CE5	1.37e-153	1	234	1	234
UQC76608.1|CE5	1.12e-58	10	235	13	240
ATZ52428.1|CE5	1.36e-58	21	234	27	235
CCD33982.1|CE5	1.36e-58	21	234	27	235
CCD43014.1|CE5	1.36e-58	21	230	27	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	1.95e-14	28	235	2	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	6.53e-12	27	235	1	207	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
2AXE_A	6.53e-12	27	235	1	207	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1G66_A	8.99e-12	28	235	2	207	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
4PSC_A	2.49e-06	13	227	67	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2J8C362|CUTI1_VERDA	6.33e-14	18	235	15	230	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.27e-13	27	235	32	238	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	7.14e-12	13	235	9	234	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A6WFI5|CUTI_KINRD	1.12e-08	28	221	36	204	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999716	CS pos: 20-21. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_134906-t33_1-p1.