CAZyme Information: ASPCADRAFT_132020-t33_1-p1

Basic Information

• Species: Aspergillus carbonarius
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus carbonarius
• CAZyme ID: ASPCADRAFT_132020-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: glycosyltransferase family 20 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939	KV907503|CGC5	105484.85	6.1225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcarbonariusITEM5010	11735	602072	260	11475

• Gene Location: location=KV907503:105597-108486(+)

Full Sequence      

MTIYIASLFLPYTVNFHVSDPQTRRAEGTTPQSANPAETATTSTPNVALSLFERNNGGPS
VGLTPGATTEHERIFAADISKAEQEHSGFPFPPKTDGDVNFLTESEAHSPAWGSTLALNQ
PRPRAAFPASPSILKHQDLTTPGAEPTKEKTKPAPKPPIAHIHDHWGGHSRKSSFSYAEW
TIETAEQGNGGLRNAVRSATDAGQLEDKAWVGTLGMPTDALPEHTKAAIAEKLEDEYGSL
TVYVSDGDFDGHYTHFCKTILWPVFHYQIPDNPKSKAYEDHSWIYYVKTNQAFAERIARN
WKRGDSIWVQDYHLLLVPAMLRKLLPDAQIGFFLHIAFPSSEVFRCLAPRKELLEGMLGA
NLVGFQTEEYCRHFLQTCSRILCVEATNDGLQLEDRFVNVGKFSIGIDPTSWDQRRQAAD
VERWIKTISDRYEGKRLIVSRDKIDQVRGIRQKLLSYELFLNTYPEWRDQVVLIQVATST
TEQPELEATISDIAMRINSTHSTLAHQPLVFLKQDLAFPQYLALISVADALIITSLREGM
NLTSHEFVYCQDGKWGNKKYGSLILSEFTGSASVFGEHALLVNPWDYRQCAEAIHTALSR
DEKERQEVWTQLHQAVLQNSTHNWVKSFSETLSRVWNEQSSREIMAVPRLQVNKLEEMYR
RSSRRLIIVDYEGTLASWGSPKSIIVTTPQRAITTLAELTEDTQNVVYVMSARMPEEMER
LFRLVSGLGLIAENGCFVREPHSEIWLKLTDKVQTDAWKAAVLHILEYYQERAEGSWVEQ
RHCSLMFHYESAEDQVAASRLASECAGHINDACMNQGVHAVPVERALVVEPAGINKASAA
EVAWRSCLKQSQRDENVGRPDFLLAIGDGRDDEAVFRWANKLASAGAVNYAMTVTLGSRS
TEAKATLTQGVTGKNPKDLFEDPLDRWRYMNDANRSVVA

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	183	634	1.6e-158	0.9305263157894736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	181	628	19	458	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	170	634	14	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	3.25e-170	190	904	28	707	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	1.07e-162	181	640	35	486	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	1.30e-124	180	841	32	684	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46441.1|GT20	0.0	1	914	1	912
BCS07788.1|GT20	0.0	1	913	1	911
BCR95224.1|GT20	0.0	1	913	1	911
QMW41842.1|GT20	0.0	1	913	1	913
QRD86165.1|GT20	0.0	1	913	1	913

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	1.85e-99	215	635	47	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5DXF_A	3.80e-98	180	628	57	519	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HVM_A	6.53e-95	181	635	24	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	9.41e-92	215	628	58	470	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	3.62e-88	189	643	31	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	4.34e-198	167	878	182	895	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	7.99e-190	4	911	5	879	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38426|TPS3_YEAST	7.69e-159	175	839	309	948	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	3.18e-158	166	845	319	988	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	9.25e-119	176	868	33	690	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.783923	0.216081

TMHMM  Annotations     

There is no transmembrane helices in ASPCADRAFT_132020-t33_1-p1.