CAZyme Information: ASPBRDRAFT_76693-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_76693-t33_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		49091.94	6.6623

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878687:973302-974846(+)

Full Sequence      

MKQPHFHPRGSREEGNIPLSNPQPSKRGNNNDPALFLNGWTLSLRCAWSAEIISLLSSHP
RYPHESSSLRTSSMLPSTLRSSRYGRFVILTIPLLVFSCLLFLTWDPLPGRLRQQSQVPT
SQSDPVSQVPQAVEPSKGEASHPKPPVSTSKPSSSKITGDIADGDAILGITDKLWQSAKD
PHLSDDQDKWINTWLEKNPSFRYELLTDDSAATFVRTHYASRPDIIEVFETLPIPILRAD
LLRYLLVLAEGGVWSDLDVTCDKPVGEWVPTEYKNARIEMIVGLEFDFEWRGEGTEIASQ
FCNWVFAAPRSSRVLQVVVDAVVAKLKEIAAMNNVQVKDLTLEMLPIDVVNVTGPKIMTI
AILDSLQQLLGRTVDDRDFHGIKKPKLIGDVLIMPGVAFAASQNGYPQDQGDALVTHHYA
GSWKQADAEAKEKKKQKQNGR

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_76693-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	188	271	3.1e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.79e-18	170	287	82	198	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.74e-15	184	273	1	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46331.1|GT32	2.19e-257	25	441	5	417
BCS02801.1|GT32	3.11e-242	62	441	23	403
BCS14453.1|GT32	1.87e-237	74	441	1	369
QKX62870.1|GT32	1.16e-126	74	438	1	378
QQK48128.1|GT32	1.57e-124	152	437	68	353

PDB Hits     

ASPBRDRAFT_76693-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.07e-28	174	424	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.12e-24	189	424	122	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.50e-22	174	399	134	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.93e-15	165	316	91	276	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.94e-07	166	263	56	147	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000004

TMHMM  Annotations     

Start	End
84	106