CAZyme Information: ASPBRDRAFT_76463-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_76463-t33_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844	KV878687|CGC9	92531.36	8.2485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878687:21472-24428(-)

Full Sequence      

MTPTQRTDDLAADASEGEKKARFWKKPVRSGVTVLGVCSSENGRLDIDLSEWGFPGWLAE
VENHLLPHVVSGQTGQLSSPNTVPSVGDTLPLGLNIVIHVVGSRGDIQPFLALGRSLKNC
GHRVRLATHLAFQQLVKDTGLEFFNIGGDPAELMTYMVRNAGLLPEFKTIRTGAVRRHRR
DMKNIINGCWRSCVTAGDGTSLDSTPSDHTGIESGQRPFVADAIIANPPSMAHIHCAERL
GIPLTIIFTMPWSPTQAFPHPLANIRRHSTRPSVANFVSYNFVDMLLWQGLGNIINTLRR
KCLHLDILDASQALGLLHRLHIPHAYIWSPALLAKPLDWYEEIDICGFVSAPAEIDYQPS
DDLFNFLRRGPPPIYVGFGSIVVDNPRQLSELVIDAISRTGQRAIISKGWTGLDTGGLEV
PEHIFLLGDCPHDWLFQHVSCVVHHGGAGTTHAGLSHGCPTIIIPFFGDQLFWGSIIAQL
GVGPSPIPYKELTIGKLADAIGVALEPSTKQKAYQVSQLMNCESGLEKAISSFHDHLPLW
RMRCAVCHSRPAVWKVKGSQLILSGFAMTVLVGAGLLKPNEITLYRVIDYDTSRNPQNPL
SAASQVLLGSFSKFVTDIGDVYSAMLAGIPCRSNRADNNSGFSVRRDTGPQLSSQDRNIH
ILKSQNFKARPVGRLCQQILNIIIIPPMEITLTISKGFHNATRLLHDDTVKSIPKVTCLR
SGVKTAAKELISSVHDSFSGLIIHPSRGLQESGVIGFFKGIGKGLTGALCKPMAGLWGLA
AYPLAGLHEHLQSALSEGKLSYIKRARVAQGIDELRESTFEERADVIRQWYVLCPSRRDH
RHDE

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	213	530	6e-53	0.7486910994764397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.25e-77	94	536	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.84e-36	96	529	4	391	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	3.64e-17	96	259	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	4.30e-08	368	501	222	353	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	5.79e-05	690	780	2308	2402	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR87280.1|GT1	2.48e-278	8	833	17	886
QMW26747.1|GT1	6.25e-277	15	833	32	934
QMW38826.1|GT1	6.25e-277	15	833	32	934
UCK59363.1|GT1	1.25e-276	15	833	32	934
QQK47597.1|GT1	2.29e-272	36	833	48	931

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.01e-71	101	537	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.01e-71	101	537	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	3.50e-33	94	517	1	379	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.15e-29	94	517	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.28e-22	94	520	1	383	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.02e-128	94	538	156	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	4.07e-123	94	538	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	3.19e-76	94	538	1164	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	1.36e-72	95	591	698	1182	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	2.17e-70	101	537	1002	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_76463-t33_1-p1.