CAZyme Information: ASPBRDRAFT_672242-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_672242-t33_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	KV878683|CGC5	37008.20	5.8521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878683:99802-100901(-)

Full Sequence      

MKDFTMHSAYFPRGRSQRFWLRSLSNMVMVFMAVVGLVKMFSHFHPHEMQTSDSQPIIRK
VTMVYGNRTSYYRGLKTHEDHSSKFGYPMTVLRKPILGGYWSKPAILLSALVEEMEKPEE
NQAKCWFDGDTILMNPNIPLDIFLPPPQFDDTHLLMTSDWNGMNNGVFFIRVNQWAIELL
SATLAYPTEHPEVSLSFADQSAMDNVILDHEYFRRSIVFYPLRWFNAYPRNADAVDLNPD
RPVDSQVHHGDLLVHFPGAPPDRFDEIMDPYLKVAEAHTPEWELPLQKTGYMKEIGDFWR
ERHELIFGETLESSDSLK

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_672242-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	73	262	2.1e-24	0.8699186991869918

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	2.21e-14	37	258	6	231	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	0.004	81	182	163	264	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96623.1|GT34	9.26e-123	63	314	1	242
BCS22997.1|GT34	4.94e-94	11	300	17	307
BCS22806.1|GT34	1.98e-91	12	299	73	359
QKX62037.1|GT34	1.22e-89	58	300	302	548
QKX54237.1|GT34	3.30e-86	26	299	5	284

PDB Hits     

ASPBRDRAFT_672242-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	5.01e-07	50	258	113	332	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|A2X933|GT7_ORYSI	4.27e-06	90	192	164	267	Probable glycosyltransferase 7 OS=Oryza sativa subsp. indica OX=39946 GN=GT7 PE=3 SV=2
sp|Q6Z5M3|GT7_ORYSJ	4.27e-06	90	192	164	267	Probable glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=GT7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000004

TMHMM  Annotations     

Start	End
19	41