CAZyme Information: ASPBRDRAFT_666692-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_666692-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834		91032.89	5.3707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878702:120532-123093(+)

Full Sequence      

MKPIQPIDIDAILPQLTLDQKASLVAGSDFWHSMPIESLGVSAIRFSDGPNGVRGTKFFY
GTPSYCVPCGTALGATFDTELLWKIGNLLGREARDKGVHVLLGPTMNIQRSPLGGRGFES
FSEDSVLSGELGAAYCLGVKEAGVIPTPKHFVCNDQEHQRIAVNSIVTQRALREIYLRPF
QIALAKARPAALMTAYNKVNGIHAAEDPHLLLNILRGEWGWEGLIVSDWFGTYSVSAAIR
AGLDLEMPGPPRFRGAALSHAISSGKVDESTLDQRVRAMLHLINEAARSGIPTGGSEVHH
DRPADQELLRTAAADSIVLLKNDDGILPLRRDRSVAVIGPNANYARYCGGGSASLEASYT
VSPLDGIRAQASDVRFSQGSYSHQQLPLLGEQLKTPDGKTGFSFRVYYDPPEATHRELAE
ELLLTQSEGFLMDYADSRFRTCDFYIDMEGYFTPEEDGIYDFGVSVCGTGRLFIDGALIV
DNATKQTGGTSFFGSGTREERGSMSMVAGRRYRLDFLFGSSFTSNFERRGAVAFGPGGFR
FGGCKRLDPHKAIDDAISVAQAADQVVVVVGLNGEWECEGYDRDSMEMPPYSDLLVKSIL
QVRKDAVIIVQSGTPVTLPWVSQASALLQAWYGGNEVGNGIADVLFGSVNPSGKLPLSYP
INIWDTPAYLNFGSESGRVLYGEDVYVGYRYYEKTRTPVLFPFGYGLSYTTFNQTNLVVS
TTQETITVSLTIQNTGSRAGAEVVCIYIVPTAGTEIKRPMRELRGVGKRFLEPGASTNVV
IEMPLLSATSYWHESRNAWLSEKGEYKVLVVTGTNSAEQNATFLVDETKQWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	248	6.1e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	7.56e-73	29	343	48	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	4.00e-66	68	823	121	762	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	6.11e-43	317	709	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	8.16e-35	54	282	78	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.05e-31	11	781	55	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61980.1|GH3	0.0	7	834	4	839
QMW44618.1|GH3	0.0	7	834	4	839
ABF50853.1|GH3	0.0	7	834	4	838
QMW32588.1|GH3	0.0	7	834	4	839
QRD84089.1|GH3	0.0	7	834	4	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.50e-240	8	834	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.79e-236	8	834	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.03e-132	7	810	3	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.86e-116	16	825	12	661	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.95e-99	9	832	4	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BB53|BGLI_EMENI	0.0	7	834	4	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B0Y8M8|BGLJ_ASPFC	0.0	9	834	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	7	834	4	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WU49|BGLI_ASPFU	0.0	7	834	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	0.0	7	834	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999724	0.000314

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_666692-t33_1-p1.