CAZyme Information: ASPBRDRAFT_60002-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_60002-t33_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796		87540.75	7.2668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878701:118308-121072(+)

Full Sequence      

MTSNEGSETFGLPAEYMRQPAGTGKGETNVNDDGRVTVDWDSTFVRRFSKLYTGPFIPRP
SIPPPEYSELPAQFAGDPAEDFGPPPEYPETTIKSGKAWKVKLNIVIQVVGSQGDVQPFI
AIGQELQRYGHRVRLASHNIFEDFIRESGLEFYLIGDNPAELMAYMVKNPGLIPAMESLR
AGKIRRKRMIIREILDGCWRSYIEPDIVTGQSFVADTIIANPPSFAHVHCAQALSIPVHL
IFTMPWSSTEAFPHPLANMKGDDTDKGFKNYVSYGVVSWLIWQGVGDVINKWRKKLDLEE
IAMFKGPHLPEQLRVPFTYYWSTDLVPRASDWPAYIDICGFIFRESPQYEPPADLQAFLA
SGPPPIYISFGSIMVENPDFITATVVNAVNAVGVQAIISRGWSNLSGTDHENIYYIGDCP
HEWLFEQMAAIVHHGGAGTTACGSRKSKPTLIIPFFGEMESEAGVHAAVSSFHRHLPLER
LECDLYPGQPAVWSCSRKGTKVKFSKIAAETLVADGLVKRKSLTMHAISQILIENRRWDP
ITGGASAVMCTATDLTELQDYYEGRSARPPNSISNRMAQESRNNPCVDRMSKNDERSPHG
IDTAGFDGSIKTPSGQGRGRILGKMARASAKSLGSFVPTALKGMTVDIPLALTEGLRNVP
RYYGEEPRDHGAITNIKSGFTVAGKGFAWGMAEAVSDVIIKPYQGIQEDGPRGAVTGLGK
GMANMASKAGCAMFGVIVYPSAGIAKSLHTLIHSQTGKQIANARHGEGMWLRESNQYPGT
DNIVFSFQEMLKRGKR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	129	458	4.8e-31	0.7931937172774869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.43e-51	103	465	1	351	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.24e-27	105	458	4	331	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.09e-23	105	253	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86527.1|GT1	0.0	1	796	1	868
BCR84763.1|GT1	0.0	1	796	1	874
BCR98772.1|GT1	0.0	1	795	1	870
BCS11094.1|GT1	0.0	1	795	1	870
CAP93840.1|GT1	0.0	1	792	1	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.61e-66	86	464	8	379	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.88e-66	86	464	28	399	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	3.04e-19	103	464	1	338	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.00e-18	103	464	1	321	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	2.35e-17	103	469	1	344	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	9.54e-97	102	479	155	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	4.80e-95	103	458	193	542	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q8NJS1|ATG26_LEPMC	1.18e-62	103	458	957	1308	Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans OX=5022 GN=ATG26 PE=3 SV=1
sp|A7A179|ATG26_YEAS7	4.77e-62	86	464	728	1099	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=ATG26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	6.86e-62	102	476	994	1376	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_60002-t33_1-p1.