CAZyme Information: ASPBRDRAFT_58148-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_58148-t33_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790		87769.60	5.1767

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878691:102246-104723(-)

Full Sequence      

MKFTFQVVIAWKLAATAAAARQSKFVTLEPYFNNKAFGAYPGQTSFDALNQSYPDPKIIG
INGTYTSTHTGVVYDFPGYRGPVLPDNVVCEGQTIIVPRDQYFSVSMLVTSDVQLSTVSG
NVTYTYSDNSTLVSELHSLPWWAFLTINRGEIIFPYRYTHNDTNFNTSHIFEYTAALDPN
RTLHSITLPVTTNTTTGRLHIFSVSLWKSTTASAQVQFVRPTQKWTESGNQIVEVTVNNP
GTNCIAGPGVNLSLSMPGIQTVEPGNIKRLCPGDQKRVNIGVNGTANGTATIVLNYTHSI
QHQTYPHPLSLGLTDWTSDLSSLSQHESPEWFDDAKFGIMIHWGPYSVPGWGNSTPYESY
AEWFWWYTTHRAADKSDTYDYRLRTFGPTWNYDDSFPSFTASNFSPTAWVDLIAASGAKY
FVLTTKHHDGFALFDTQNTTNRSSLHYGPHRDLVSELFTAASTHHPSLKRGTYFSLPEWF
NPDFGPYGFAELPGNTSTSWPGIIARNPYTGQDEPYTGRIPVNDFITDVMVPQMTILANN
YTTDIMWCDCGAANGTASFASEWFNTARAQNRQVTINSRCGVAQVSDFDTPEYATFSSAQ
LRKWESNMGMDPYSYGFNRATARDSYMNASTVVQDLVDMVSKNGNFLLDVGPRADGSIVE
REERELRRAGEWIRGHGEAVFGTRVWWVRSEGLGVKLGDGDGDGEQVGVRFTQTNEAFYL
LFLGHPGSTVFVDAPVPLLKGDRVVVVGGDGEESEVDWEGSAAEGFTFRVPKGAWDGEAF
CWVLKVVYVA

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_58148-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	316	682	2e-90	0.9190751445086706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	4.10e-94	319	726	10	374	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	8.59e-84	322	678	12	333	Alpha-L-fucosidase.
226195	AfuC	3.05e-37	342	713	1	357	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93111.1|GH29	0.0	1	790	1	789
BCS05767.1|GH29	0.0	1	790	1	789
QKX54848.1|GH29	0.0	3	790	7	797
CAK41610.1|GH29	0.0	256	790	1	531
QDS68271.1|GH29	0.0	1	790	9	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ODU_A	1.36e-60	319	787	11	447	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	1.57e-60	319	787	11	447	alpha-L-fucosidase [Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]
1HL8_A	2.59e-60	319	787	11	447	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
2WSP_A	1.30e-59	319	787	11	447	Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8],2WSP_B Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8]
7LJJ_A	3.44e-50	297	772	19	496	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17164|FUCO_RAT	4.12e-64	316	789	33	461	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
sp|Q99LJ1|FUCO_MOUSE	1.54e-61	309	789	16	451	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
sp|P04066|FUCO_HUMAN	1.57e-61	316	789	37	465	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
sp|Q2KIM0|FUCO_BOVIN	6.03e-61	316	789	40	467	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1
sp|C3YWU0|FUCO_BRAFL	5.06e-60	322	786	24	445	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000622	0.999370	CS pos: 19-20. Pr: 0.9606

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_58148-t33_1-p1.