CAZyme Information: ASPBRDRAFT_53405-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_53405-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		82134.93	5.1937

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878682:325569-328496(-)

Full Sequence      

MYSKEPSYPSPNATGRGGWDVAISKAKRFVSRLTIEEKVSICTGTGLPPEPYTPDHTCQG
NIQSIPRVNFSGLCYTDSDTGIGNAHSYGTGFPPGVTVASTWNRELMRARGFAIAEEFKA
KGIHAVLGPVLAFARTVGGGTNFEGFGNDPYLIGVAGYETVTGHQGAGVQAEIKQYIGYD
GQQYNRTYYSSNMDSKTFHEVYLWPYAEALRASPACVMTSYAYVNNSYSSQNAYLLNDVL
KTHLGFQGYTQTDWFGLKAGVAAVLSGLDQDMPGVAADSGSWSFFGTNYTEAVKNGSIPE
WRLTDAAVRIMTPYFWLGQDRGYPQVNLVDDPRLTITDSQRQRHRTLACEIAAAGTVLLH
NTPGRKKGLPLGKPTTITLFGPAAGQNPGSVDDIGYAEGTLANGGGSASTFYPRLIDPIS
AIQQRAAEDLTLVDWITTTTNLTYTASIAQRGTVCIPIVSSFSGEGTDRTLTLLHNGDQM
IQTVANNCANTIVIIQSVGPINMESWVEHPNITAILWTNLGGQELGPALVDILYGKVNPS
GRLVYTIARNISDYPNQGHIIKEPQPYPQIDYTEGVLVDYRGFESNQEKTPPRFWFGHGL
SYSNFTYSNLQIRKQADLDTMLERPIEYVADAPGGDSKLYDVAVVVSFSIRNEGPYDGVE
IPQLYLRMPGEAGNINSTTTNSTMAKVLRGFESVRVRDEETQEVRLFLTRKDISYWSTGE
QNWVTPSGGGSRFEVLVGASSSDIRLYGEFVL

Enzyme Prediction     

EC	3.2.1.21:16	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	64	273	1.6e-48	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.85e-48	86	752	114	764	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	2.67e-45	356	580	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	5.02e-45	85	403	76	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.90e-35	76	312	72	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.82e-32	7	704	39	738	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SHO79579.1|GH3	1.43e-181	1	746	51	797
APA11856.1|GH3	1.12e-171	6	750	33	801
BCS18193.1|GH3	1.42e-170	6	745	52	809
QDS71883.1|GH3	1.96e-169	6	745	34	796
QQK43178.1|GH3	1.98e-169	2	745	47	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	4.01e-154	6	746	27	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
4IIB_A	2.06e-149	6	747	8	834	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
6SZ6_A	4.66e-146	3	724	3	812	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
3ZYZ_A	1.51e-143	19	746	9	706	Chain A, Beta-d-glucoside Glucohydrolase [Trichoderma reesei],3ZZ1_A Chain A, BETA-D-GLUCOSIDE GLUCOHYDROLASE [Trichoderma reesei]
4I8D_A	1.56e-143	19	746	10	707	Chain A, Beta-D-glucoside glucohydrolase [Trichoderma reesei],4I8D_B Chain B, Beta-D-glucoside glucohydrolase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B0F4|BGLG_EMENI	1.69e-165	2	745	48	809	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|Q2U325|BGLG_ASPOR	1.31e-163	1	744	46	804	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|B8NMR5|BGLG_ASPFN	1.31e-163	1	744	46	804	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q0CUC1|BGLG_ASPTN	1.54e-162	1	745	46	805	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1
sp|Q0C7L4|BGLM_ASPTN	3.32e-158	6	750	38	780	Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_53405-t33_1-p1.