CAZyme Information: ASPBRDRAFT_50176-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_50176-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46987.96	4.1724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:1331210-1332675(+)

Full Sequence      

MTRILPFSVILLTGLLSHSEPVAAVGRSCDPDTRPYSAWMTDSVIARRDAILGTFAAGDD
IYPNISRLALFESTVTRLKEYYDADSCGQVDWHSYALEGAESLLPAVQNVTFDVNAPLTV
FASGDVMYHQYDRAPNETYKQALDTLHDAFNARTRDSEGAYWYFNPYPNVGVLEGLYPLS
SFISMWKTYFDPTNTTLTDSLILSLDLFKDHCHDDSSGLLFHGYDSSKTASWADPTTGAS
PYVWNRALGDWFMTLVDLLERSDKHSAILNETQRDDVYTKYWNVANTIINDADEETGCWW
QVMLHGGEEGNYIESSGSAQFVYGLLKGARLGYLQGETPTGVGYTDAADKCYNYLVSEFV
KEEADGTLGYNGTVADCGLYNPTFEYYTTRPIEYNNVFGTASFILASWEHEMFETGYYT

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_50176-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	121	411	6.9e-63	0.8012048192771084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	6.09e-31	130	413	84	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	2.51e-29	136	411	97	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99486.1|GH105	1.39e-293	7	419	8	420
BCS11787.1|GH105	1.39e-293	7	419	8	420
CAK42095.1|GH105	5.93e-268	7	385	8	386
QRD85043.1|GH105	8.13e-117	8	411	13	416
UDD61061.1|GH105	1.31e-115	8	411	13	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.02e-42	123	411	79	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.25e-36	85	411	55	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.31e-36	85	411	45	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.70e-35	85	411	55	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.04e-20	215	406	35	224	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.04e-20	215	406	35	224	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000461	0.999529	CS pos: 24-25. Pr: 0.9076

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_50176-t33_1-p1.