CAZyme Information: ASPBRDRAFT_50009-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_50009-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		41555.43	6.2903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:750009-751145(-)

Full Sequence      

MPGHFGQKILNTFGIDHHGHGQGQGQGQPYQQPPPPGDNRLAGNRIIHNDERLLSPHPAG
TYPRLARLHDGRILASFTRFVGGGERVLMVSISHDNGQTFTDHGEISRGTGDIDNVYLLE
IGPGTVLAAFRNHDIGPGGPTHFRITVCRSTDSGRSWSFASQAAEKPAPLGIWEPFMRLG
RRPGEIQLTYSQEFAHNNQCTMLVRSYDGGSSWSAPQCLHGAEDQRRDGMNGIARTWDPV
RNCEALVMVFETTTYGTFDVEALVSYDDGETWGGRQQVYVPPQGHNAGAPQIASLGDGSL
AVIFMCDEDFREVEWTKNACVKVVFGSMPHDGRVMWTNPTTVCGDSSHWPGIFTLDDRRL
LALYECGGPKAKTIALEW

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_50009-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	59	318	6e-68	0.8925081433224755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	8.74e-10	70	309	87	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	2.22e-09	118	371	19	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	2.93e-04	55	158	194	294	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
214740	VPS10	0.007	90	217	12	116	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	1.69e-275	1	378	1	377
BCS11580.1|GH93	1.69e-275	1	378	1	377
BCS24955.1|GH93	3.67e-177	1	376	1	364
QMW42642.1|GH93	3.49e-176	1	376	1	378
QMW30589.1|GH93	3.49e-176	1	376	1	378

PDB Hits     

ASPBRDRAFT_50009-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPBRDRAFT_50009-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_50009-t33_1-p1.