CAZyme Information: ASPBRDRAFT_47409-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_47409-t33_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		40076.72	4.8033

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878692:348056-349255(+)

Full Sequence      

MGLLRCIGLILLGLEAALAQSSSQKWDLKDFKTLVTFGDSYTDDTRISYFFNHNGSAPPV
GWVEPITNSSSSGGYIWGHFVHQYANLSHRYNYAVSGASCSNKITPRATSFGLYPSVLEY
QVPAFTADNAYHLPNTGEKFLHNDPDSTIYSIWIGTNDLGNYAFLTDSQVANKTIPDYID
CVFNALDGVYTAGKGKYFVIMNMVPLQLAPLYATPENGGIGENNYWPDKSGNFTEISYRM
WEQVSTVNQVYDYRAPFEWVVRKRYPGAKVAVMDMYELISDIYYHPKEYLNGSAPANVTG
YIHHCDVEGSECQTLSSPDSFLWYDQLHPSQRTDEIIAEEFVKVVRGESAYATYWS

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_47409-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	34	341	8e-72	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	8.05e-48	33	342	1	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	6.54e-11	85	341	72	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.09e-09	34	341	1	224	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	6.33e-08	11	339	9	327	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
178701	PLN03156	9.87e-05	263	345	261	346	GDSL esterase/lipase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15697.1|CE16	5.85e-249	1	356	1	355
BCS04097.1|CE16	5.85e-249	1	356	1	355
QMW44554.1|CE16	4.36e-153	7	355	8	353
QRD84022.1|CE16	4.36e-153	7	355	8	353
BAE62044.1|CE16	4.36e-153	7	355	8	353

PDB Hits     

ASPBRDRAFT_47409-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	8.85e-86	30	355	26	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999759	CS pos: 19-20. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_47409-t33_1-p1.