CAZyme Information: ASPBRDRAFT_46150-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_46150-t33_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28206.28	4.7374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878689:195302-196132(+)

Full Sequence      

MVSFLSQARLAVPILSAFAWMFAASSAIPPPPHGALSPERLQWIREVIGNQTEDGSIPDL
TKRSNIISTSQDGVDSAGFYYSVYNDNGASVGYTEYPTTGQFELGWKTSTEFLGGKGFKG
GSPRSLTWDGYFTAEGDWTLAIYGWTTNPVTEWYIVESHGTGTPGNGHILGQVESDGGTY
DVYDLPYRNVPEIYGVTNFEQLWSVRRTHRTTGTVNVNAHFQRWKELGLRPGTPVFQMVT
LEGFSGQGYLDFTLSA

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_46150-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	78	251	2.1e-49	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	6.95e-61	77	251	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02029.1|GH11	1.87e-170	1	256	1	256
BCS13717.1|GH11	1.87e-170	1	256	1	256
ALN49265.1|GH11	3.11e-169	1	256	1	256
CAG17889.1|GH11	4.23e-167	1	256	1	256
CAK97322.1|GH11	4.23e-167	1	256	1	256

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WP3_A	8.33e-48	59	255	13	207	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
1TE1_B	2.26e-46	67	255	3	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
4XQW_A	2.47e-45	78	255	11	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]
2VGD_A	2.89e-45	67	255	27	215	Crystal structure of environmental isolated GH11 in complex with xylobiose and feruloyl-arabino-xylotriose [Escherichia coli]
2VUJ_A	2.97e-45	67	255	27	215	Environmentally isolated GH11 xylanase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CFS3|XYNA_ASPTN	1.09e-47	76	254	52	230	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1
sp|P55332|XYNA_EMENI	2.57e-47	76	254	46	224	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1
sp|Q4WG11|XYNA_ASPFU	2.81e-47	18	254	4	227	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1
sp|B0XXF3|XYNA_ASPFC	2.81e-47	18	254	4	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnA PE=3 SV=1
sp|A1DNU5|XYNB_NEOFI	3.24e-47	59	255	28	221	Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.092196	0.907780	CS pos: 27-28. Pr: 0.6944

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_46150-t33_1-p1.