CAZyme Information: ASPBRDRAFT_45473-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_45473-t33_1-p1
• CAZy Family: GH6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270		28539.68	4.6235

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878687:1131162-1131974(-)

Full Sequence      

MTRSIFIHTLVALSALTSVQGANSPGCGKNPSLANGVHQINGREYTLKIPDDYDANHPYH
LIFGLHWRGGNMNNVVNGDSIQPWYGLESRSQGSAIFIAPNGLNAGWANTNGEDVAFIDA
IMEQVESDLCVDQSSRFATGFSWGGGMSYSLACSRAKEFKAVSVLSGGVISGCDGGNDPI
AYLGIHGINDPVLPFDGGVELAERFVGNNGCQPASIEKPQSGSNGWKRTDFDGCSKPVSF
IAYDGGHDGAPLGVQSSLAPDATWEFFMAA

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_45473-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	43	171	8.3e-21	0.5814977973568282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	4.81e-17	42	267	46	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
226584	COG4099	2.87e-07	45	226	176	363	Predicted peptidase [General function prediction only].
223489	DLH	4.02e-06	118	194	96	173	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
223477	YpfH	0.002	113	205	78	172	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB17085.1|CBM2|CE0	1.04e-90	26	267	38	285
EGX54170.1|CBM1|CE0	2.12e-89	22	267	92	352
AYC36484.1|CBM2|CE0	7.17e-84	22	267	42	302
UDD56959.1|CE0	1.48e-83	10	267	10	272
AEB46202.1|CBM2|CE0	3.61e-83	22	267	18	279

PDB Hits     

ASPBRDRAFT_45473-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYU7|FAEC_ASPNC	1.29e-200	1	270	1	270	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	3.25e-169	1	270	1	270	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|B8N7Z6|FAEC_ASPFN	3.69e-159	1	270	1	270	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|Q2UI81|FAEC_ASPOR	1.23e-157	1	270	1	270	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2
sp|A1C9D4|FAEC1_ASPCL	2.19e-156	1	270	1	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999729	CS pos: 21-22. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_45473-t33_1-p1.