CAZyme Information: ASPBRDRAFT_44564-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_44564-t33_1-p1
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		64569.93	5.4927

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878686:349781-351905(+)

Full Sequence      

MAAEYDYVIIGGGTAGLVVASRLSEDPSISVLVLEAGADLTADPRVNIPVFYAALLGSDA
DWKFRSSPQPGLNGRVIGLNQGKALGGSSSLNAHVFVPPFKGAVDSWETLGNPGWNWSMF
KDYLSKAYTSPTVAQDAREGLAIEDWPEVSEAKGLIQTSFGNQTHPIRKAWAELFHSRGQ
RNAADPFIHSSVGSFSCLASIDSEGRRSNSASAYYKPVELRQNLHVLTNALVEKILFDES
KPPRAMGVQYSLDGASKTVQAKSEVILAAGAFQSPKILQLSGVGGADLLEKHGIDVVMDL
PGVGQNLQDHMISYTAFQANPEIETKDSLIRQEPEALGQAMQEYTATKSGPLASLGVHTY
AYLPLPESDRSALQALLTDHTPESSRRHRATQSYYNIAKTTILDAKQPSAAYLAALGQTN
YAKDLTDGTIPAASPGKFVTLGVMLSQPLSRGSVQITSTNPEDPPIIDPGYLSNPLDLEV
ISRHLLSIKDLAASPQLGKLLEQPLKFRDPACDFQGDLDAAKKYAQDNLVSMWHFAGTCS
MLPREKDGVVDSKLKVYGVEGLRVVDASAIPLVSTANLQATVYAFAERAADLIKQDRKGE

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_44564-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	596	1.8e-178	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.03e-104	1	594	2	532	choline dehydrogenase; Validated
225186	BetA	3.51e-99	1	598	4	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.20e-38	448	589	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.49e-32	5	599	56	582	Protein HOTHEAD
366272	GMC_oxred_N	1.48e-31	73	312	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16880.1|AA3_2	0.0	5	600	6	600
BCS05325.1|AA3_2	0.0	5	600	6	600
QMW48092.1|AA3_2	0.0	1	600	1	599
QMW36031.1|AA3_2	0.0	1	600	1	599
QRD93013.1|AA3_2	0.0	1	600	1	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.94e-78	4	597	1	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.60e-78	3	597	1	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	2.03e-72	5	598	6	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.39e-68	3	598	4	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6ZH7_A	1.01e-60	1	593	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	1.38e-90	5	596	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.38e-90	5	596	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.94e-89	6	596	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	4.59e-78	4	593	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.59e-78	4	593	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000018

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_44564-t33_1-p1.