CAZyme Information: ASPBRDRAFT_43172-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_43172-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		74910.44	7.2191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878684:808600-810654(-)

Full Sequence      

MLSCRQLLQLLLAISLPAAAINLTGYEYIVVGSGAGGGPLAARLALAGHSTLLLEAGTDQ
GYNFNTSVPGYAALAAADDHLSWNFFVRRYADDAQQARDPKTVYTTPTGEQYVGLHPPRG
SIMKGILYTRASTLGGCTAHNALITIYPHRSDWTYIANLTNDPSWLPESMREHYIRLENN
HYLPRGLPGHGYTGWFSTEHAPINLVLQDPQLLFLLLGAVFTQPRHILTNLISLLFGDLN
AAAPSRDSKPAYYQIPLATASNRRNGAADFLRAVHDARNQDGTLKYPLTIRTNCHVTRVL
FNTTTHNNPPKATGVAFLDGSYLYRASPLSFPNTPRTPGTATATREIILSAGVFNTPQIL
QLSGIGPADLLNKHNIPVLVNLPGVGANLQDNYEASVVVEAPFRFRILNGCTFNYKSDAC
LTRWLNPIPKGHKHKDRGIYSSAGFTSALIHHTPFPNINTSETTDEDYNTLIYGGLIDFR
GYFPGIESNTTATHHSFTWAIIQAHPSTSTLSNRDTNVAKGTGTVNITSTDPLDPPHILF
NSFPDHPHSERDLYALVDAIKVARKALSRQLIPVRETLPGRNVTSYEELRQYVLDTSWGH
HAVGSCRIGRVKHSDSFDDDNNDDEGAVVDAKFRVKGIHGLRVVDASVLPRPLGTFPVLG
VYMLAEKAVGDILEFQDHGGGWEG

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_43172-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	673	1.7e-82	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.50e-56	26	674	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.33e-51	26	673	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.46e-28	523	668	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.17e-25	26	664	56	568	Protein HOTHEAD
366272	GMC_oxred_N	4.18e-14	256	394	118	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15218.1|AA3	0.0	1	680	1	658
BCS03593.1|AA3	0.0	1	680	1	636
QMW33146.1|AA3	6.13e-244	5	673	4	642
QRD84722.1|AA3	6.13e-244	5	673	4	642
QMW45179.1|AA3	6.13e-244	5	673	4	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	2.81e-32	26	667	14	521	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	2.81e-32	26	667	14	521	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	6.81e-32	26	667	14	521	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
4H7U_A	1.52e-27	26	668	41	593	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.15e-22	26	667	2	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66D54|BETA_YERPS	3.77e-33	26	667	3	526	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	3.77e-33	26	667	3	526	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|A7FKL6|BETA_YERP3	9.18e-33	26	667	3	526	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	9.18e-33	26	667	3	526	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	1.23e-32	26	667	3	526	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000599	0.999356	CS pos: 20-21. Pr: 0.9659

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_43172-t33_1-p1.