CAZyme Information: ASPBRDRAFT_42411-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_42411-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		64250.82	6.8486

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878683:1126892-1128946(+)

Full Sequence      

MADSYDYIICGGGTSGCVVAGRLAENPHIRILLIEAGQHNKDLENVHMVGGWSNLLDTTT
DWNIVTPPMSHVNNRQVKLSRGKFLGGCSGCNGTLCIRGSKQDYDDWGLDGWSGKEFFKY
MQKAETFHTKPWFKASDRHHGNSGPLHVEPHDLAPISELIMDSFVSQGLPLDHDMFTTGD
TPHGCGHVPRSVYNGLRTTSGDFVTNEYHRNNVTIMTDTTVDRVLFKKTPGGLKADGVSV
VTANGRRELHAKREIIISSGSYCSPTILMRSGLGPKEELQKNNIECLVDLPGVGQNLMDH
LIVFMFYETEKPGLTTDHHVYHGENFNKTYALWKEKKEGFLSTFPFGAFAFARLDERLKD
EPLWKNAPRQPGRDPMGLAPNQPNVEFLTTECYGGPKQYDQFPIDHKYAFSIIAELFSPR
SRGSVTLKSKDPLEKPVVDCNYLADPLDLLVLTEACRFANEIITKGAGTKDIVKGSWPPN
LTHHTYTKREQWIPYVKEHATTCYHAGGTCAMGPDGDTQAVLDNKLRVRGVTGLRVADCS
VMPTLNGGHTQMPAYGIGEKCADLIKETWTSEAFNVAKL

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_42411-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	567	1.8e-164	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.97e-104	1	566	2	532	choline dehydrogenase; Validated
225186	BetA	1.16e-99	1	567	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.16e-40	419	561	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.08e-30	72	302	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.30e-25	4	541	55	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07163.1|AA3_2	0.0	1	579	1	579
CAK49001.1|AA3_2	0.0	1	579	1	566
UDD65288.1|AA3_2	0.0	3	573	7	578
QMW48130.1|AA3_2	0.0	3	573	7	578
QMW36070.1|AA3_2	0.0	3	573	7	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	6.13e-77	5	566	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	8.58e-77	5	566	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.20e-76	5	566	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	1.03e-65	5	569	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3LJP_A	1.23e-64	5	573	14	539	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.93e-77	1	566	1	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	2.97e-74	5	569	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q988C9|4PADH_RHILO	4.23e-74	2	565	4	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A9AMZ9|BETA_BURM1	5.21e-74	5	576	6	543	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|Q2T6D0|BETA_BURTA	9.95e-74	5	575	6	542	Oxygen-dependent choline dehydrogenase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_42411-t33_1-p1.