CAZyme Information: ASPBRDRAFT_41781-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_41781-t33_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	KV878682|CGC11	30685.34	4.7012

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878682:2662713-2663555(+)

Full Sequence      

MALMNDAKKTEPTSTDTMQDDSTLRVMIVGDSMSQGKEGDYTWRYRIWEWFRAQNIAIQM
VGPYTGTAPSEPQAHGELQATLGQPKTSGGYAPDVSPDFDRHHFAVWGRVAAVDKDLIYD
VLSAHQADLMLLMLGFNDMAWFQSDAAGTLDSIRTLVINARAANPNLKFAIANVPQRSFI
PGREDLPINTNIYNALLHNAISEWSTADSPIHLVELQENYDCGPSACPAGYDGLHPNAAG
EFQIARAFSLTLVNGFGIGGSPLTIPDHVPERSHSTSFNF

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_41781-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	24	249	1.9e-51	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.44e-39	100	252	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.09e-08	119	240	54	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	2.89e-07	117	249	53	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	4.47e-06	102	248	39	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
225353	TesA	7.19e-05	120	247	70	203	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	4.38e-183	1	280	114	395
BAE63679.1|CE0	6.05e-120	23	266	56	305
BAE60780.1|CE0	1.22e-96	69	280	19	229
UKZ09962.1|CE0	4.78e-92	24	272	512	768
SCG40251.1|CE0	3.23e-88	24	272	336	590

PDB Hits     

ASPBRDRAFT_41781-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPBRDRAFT_41781-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_41781-t33_1-p1.