CAZyme Information: ASPBRDRAFT_38450-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_38450-t33_1-p1
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	KV878680|CGC10	93230.25	6.0066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878680:1877783-1880593(-)

Full Sequence      

MPLTGLQKQIGQLFAVGFHGLTPSPEIKTLIHDYGIGGIVLFKRNVSDAAQLQALTHALQ
EEARLAGHEHPLLIGIDQENGLVTRVSPPIAPQMPGPMALGATNSPDLAYQVGAATGEIL
SASGINMNYAPVCDINSEPLNPVIGVRSFGDNPEFVARFASASARGLREHKVVPTVKHFP
GHGDTAVDSHYGLPVIPKTREQLERCELVPFRQAANEAIEAIMTAHISLPGIGDGRLPAT
LSPDVMRILREDMGYGGMVITDCLEMDGIRATYGTEQGAVLALAAGCDSIMICHTYSVQV
ASILQVCQAAESGEIPSARLNEAIGRVNELKRRFLSWETALRPLESRKNWPALGADMTKH
SALAQQAYAQSVTLVRDASQILPVSRSANVVFLFPGDQTPAGGAVDGEGLGRKGSYNASV
YLDILKQYNPTVVEIRYGAAGLSAELISTIEAADVVIFTSINARESPFQRTLGLELPSRV
RKLVSIAACNPYDFLEDASVGTYIATYEPTLEAFAAAARVIFGQSEAKGILPVENPTSQL
SVEESDLANTKDILQLTAVWNAALPTYPLPTQKLQLLINQEHGHHFVARMGADIVGFGLT
YTSNASTGVVGNIAVLAVDPAKQGQGLGTALISKITAWYRDNLKLSRLELSSSFPRFFPG
IPNDLPPSVQEFFEKRGFSLWDTNPRNVDLYRDIRDFKAPDAYISRAADQGYTFGPLQPE
HYEECLAGQRKNFSANAAWVRQYEELHPTTYPFSVMAAFDSQGKQVAWTLMLGPDSPALQ
RNWALPPVCGPKTGLIGCVGVDADHRKKGLGLALLSHAMEDLRRRGAEGVFVDWVVLEGF
YEQLGLKVWREYRRATLHM

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	291	2.6e-61	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.42e-92	9	420	6	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.16e-84	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.60e-49	36	294	26	281	beta-hexosaminidase; Provisional
185053	PRK15098	3.11e-17	6	538	47	602	beta-glucosidase BglX.
404548	Acetyltransf_10	3.15e-10	569	678	17	107	Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93582.1|GH3	0.0	1	859	1	859
BCS06215.1|GH3	0.0	1	859	1	859
CAK37722.1|GH3	0.0	1	859	1	859
BCR85716.1|GH3	0.0	1	857	1	854
QMW40223.1|GH3	0.0	1	859	1	865

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.06e-159	6	853	9	854	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.17e-98	6	532	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.93e-68	24	537	74	619	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.56e-68	24	537	48	593	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.63e-67	24	537	78	623	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.51e-67	24	537	74	619	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	5.89e-56	22	533	50	594	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q0A911|NAGZ_ALKEH	1.22e-41	16	294	8	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	1.45e-38	13	294	1	279	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1
sp|Q87BR5|NAGZ_XYLFT	1.45e-38	13	294	1	279	Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_38450-t33_1-p1.