CAZyme Information: ASPBRDRAFT_36293-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_36293-t33_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		49528.96	4.1071

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:950051-951777(+)

Full Sequence      

MRLVRDCLYGGLFLNTALFSQLAHAIDIDISSTSSIKDAASKTAYGSMTWYHGNETGQIP
GAFPTKWWEGSALFTSLLLYWYYTGDSTYNDEVRQGMQWQAGDCDYMPANYSSYLGNDDQ
MFWGLAAMTAAEIQFADSSSGYSWLALAQGVYNTQVDRWDDSTCGGGLRWQIYPYEAGYA
MKNSISNGGLFQLAARLARYTANDTYADWAEKIFDWCASTPLLNNQTWNVADSTDVDNSC
KTQGNNQWSYNYGTFLTGAAYMYNYTGKAKWKNAAEGLLNVTLNTFFPSEYGGNIMSEVL
CEPAEACNDNEILFKGLVTGWLGLVALVMPSTYDTILPKLQGSAEAAAASCNGMGNNTCG
VRWYPKKWDGWNGMEEEIAVTNVLASALVNTKQTAPVTSSTGGNSSSDPNAGTGDNTGDS
NTESTITTGDKAGASILTIAFVGMWGGMIAWMVIGG

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_36293-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	398	2.5e-101	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.70e-175	35	380	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	5.56e-04	144	365	97	317	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11652.1|GH76	0.0	1	456	1	457
BCR99351.1|GH76	0.0	1	456	1	457
CAK46589.1|GH76	0.0	1	456	1	457
BAE65580.1|GH76	9.72e-241	1	455	1	455
UDD65266.1|GH76	1.13e-239	1	455	1	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.50e-92	30	412	30	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD78|DCW1_CANAL	2.95e-106	11	454	4	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	4.27e-105	20	438	16	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	6.91e-102	14	412	9	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	3.90e-99	1	444	1	435	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	2.02e-97	13	454	6	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999729	CS pos: 25-26. Pr: 0.9723

TMHMM  Annotations     

Start	End
432	454