CAZyme Information: ASPBRDRAFT_35195-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_35195-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		64718.39	6.2423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878699:388284-390029(+)

Full Sequence      

MSVQNNARFDFIVVGGGTAGNVVAGRLAENPNVTVLVVEAGVADSKDLEAIRTPSNAMEL
RDSEYDWAYKTTMVKRDDYERVEKPNTRGKALGGSSSLNYFTWVPGSKGTFDMWEEYGGK
EWTWDPLVPYLRKSATYHDDEKAYSPELKKIGQNGPLPISHSELIPEMQPFRDLLTKAWK
STGQPVNENIFDGEMVGLTHSVNSIYKGRRSGSFLFVADRPNITILPQVHSKRLIIDEAD
KVCKGVTVITPSGEELSFFANREVIVSQGVFESPKLLMLSGIGPAAELKKHGIPIIVDNP
HVGQHLLDHPGVPFVLRVKDGYGMDDYVLRAGTPQNKQAIQAYQNNHNGPLGSGFLELVG
FPRIDKYLEKDPQYRQAKASNGGRDPFCPYGQPHFEIDFVCLFGSAFQWHYPTPPKGNYI
TVMVDLVRPVSEPGEVTLNSADPLQQPNINLNYFNNDLDIVAIREGIRYAYDVLKNGEGF
KDIIEGEYPWEMPLHDDKLMKRTVLDRSQTSFHPCGTARLSKSIQQGVVDPGLKVHGIRN
LRVIDASVIPVIPDCRIQNSVYMVGEKGADAIKRDHAELYG

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_35195-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	575	6e-153	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.94e-85	9	577	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.34e-84	4	573	1	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.08e-40	429	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.27e-27	9	575	56	579	Protein HOTHEAD
366272	GMC_oxred_N	1.12e-22	88	310	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90169.1|AA3_2	0.0	1	580	1	580
QKX59780.1|AA3_2	0.0	1	580	1	579
QKD59313.1|AA3_2	0.0	1	580	1	579
QLI67929.1|AA3_2	0.0	1	580	1	579
QGI68848.1|AA3_2	0.0	1	580	1	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	5	580	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	5	580	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	5	580	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.57e-72	9	575	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.38e-72	7	575	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	5.34e-60	9	572	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	5.34e-60	9	572	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q0B711|BETA_BURCM	5.31e-59	9	573	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1
sp|A9AMZ9|BETA_BURM1	5.31e-59	9	573	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|A1CFL2|PATE_ASPCL	8.66e-59	3	567	45	619	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_35195-t33_1-p1.