CAZyme Information: ASPBRDRAFT_332117-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_332117-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		42140.65	4.3351

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878693:30406-31563(-)

Full Sequence      

MVKLLPTLVFQAGLALAAAEYLNWTTYSANGVNLGGWLEQENTIDTTWWAQYSKGADDEW
GLCVNQGSQCGPVLERRYATYITPSDIDKLASAGVNTLRIPTTYAAWVKVPGSQLYSGNQ
VSFLNNIATYAITKHSMHIIIDVHSLPGGVNGMAFGEATGHYGWFNNQTALDYSLQAIDS
VIAYVQNSSHPGSYTIEPINEPVDNTDMSAFGSPAALSDEGAAWVLKYIQAVLDKVEEVN
PNIPVMFQGSFRGEEYWSSKFSTSDNLVFDVHNYYFAGRGATGQNITTYICDDAKNGAGN
GKFPVFVGEWSIQAEYNNTFADREKALNTGLYAFAKNSQGSAYWTAKFSGNATVDGQGTQ
ADYWNYMTWINNDMIHPDEASAVCA

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	78	357	2e-153	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.10e-08	21	364	10	337	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	5.81e-07	81	350	24	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48049.1|GH5_23	2.67e-209	1	381	1	326
BAG70961.1|GH5_23|3.2.1.149	7.76e-189	14	384	19	389
QMW31304.1|GH5_23	1.48e-182	20	375	29	383
QMW43350.1|GH5_23	1.48e-182	20	375	29	383
QRD90261.1|GH5_23	1.48e-182	20	375	29	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	3.68e-184	20	375	10	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	3.50e-167	10	371	2	365	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	2.02e-13	31	316	5	302	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.16e-12	31	316	5	302	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	1.66e-29	18	363	31	353	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	2.69e-27	31	311	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	3.69e-27	31	311	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	9.53e-27	31	311	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	1.79e-24	23	350	33	349	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999736	CS pos: 19-20. Pr: 0.5904

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_332117-t33_1-p1.