CAZyme Information: ASPBRDRAFT_224226-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_224226-t33_1-p1
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	KV878679|CGC10	56976.83	4.4195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:833143-834802(+)

Full Sequence      

MAPPVILTAAVLLSLPYQLAALQPNPGNISTPATANDGTLPRSLESCLGATGASVVYTTD
AGYSNLTVADNSNYHPHPQVVVIPNSTEQVAATVRCVSAEQGRVTLTTRGGGHSYAAYGL
SGQVVIDSSQMTEIALNESTQEVTVQMGQKLGPLALAMGRAGFALPHGTCPGVGVAGHSL
GGGWGFTSREWGWLVDRIVSLELVDVTGRIRTISPKATSPNITSTDDKNDGDLWWALRGA
GSNNFGIVTSFTYRMEPAPTAIVNYNIGFATQSDCVQVLLTLQEIGSLPPTSSAGFPTSL
GGELIIDGGYEPPKAYCSFTGQYLGDMAAYNETIQRLLSPLARQSIQPLTTTSSFFTNWV
SALTNLMGDLDAPSVPQPYYAKSLVDDGHPNYTSTSISTIFSVIQPAGPDAFISFDLNGP
DATTTLPPDESVGPMAFNHRNNLFMSQIYAWDFPGFTNVTARKTAVDKISDVADAVRQAD
PEGGWQAYQNYIDPYLQDWAELYYGDALDRLKEIKKKWDPLDILNFPQGLGHA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	71	286	3.2e-65	0.4388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.94e-29	52	533	7	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	8.22e-25	78	214	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	3.39e-12	487	531	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	2.25e-06	78	278	134	327	D-lactate dehydrogenase [cytochrome]
273751	FAD_lactone_ox	7.44e-05	74	258	11	181	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD62121.1|AA7	4.62e-200	40	533	3	489
SAM83140.1|AA7	3.20e-94	15	533	7	542
QRW06655.1|AA7	2.97e-55	63	531	53	496
QRV77710.1|AA7	2.97e-55	63	531	53	496
QRW27390.1|AA7	6.77e-52	43	531	29	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO4_A	2.33e-57	43	530	13	468	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	1.22e-56	43	530	13	468	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
5K8E_A	2.65e-43	26	533	5	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6YJO_A	1.67e-42	28	533	19	504	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
3RJ8_A	1.67e-42	43	530	2	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	1.36e-42	26	533	5	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	1.24e-41	43	530	24	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|I1S2K2|CHITO_GIBZE	2.45e-38	43	530	26	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|O06997|YVDP_BACSU	2.41e-35	55	530	10	443	Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) OX=224308 GN=yvdP PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	6.97e-35	43	523	27	488	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999737	CS pos: 21-22. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_224226-t33_1-p1.