CAZyme Information: ASPBRDRAFT_197726-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_197726-t33_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	KV878687|CGC9	47227.25	4.3355

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878687:758018-759712(+)

Full Sequence      

MRLTHVLSHTLGLLALGATAEAFSRSREAACSPKKPFKPLPTSQSREKTCHVRSHGDGTD
DSDYILSALNQCNHGGKVVFDEDKEYIIGTALNMTFLKNIDLEVLGTILFTNDTDYWQAN
SFKQGFQNATTFFQLGGEDVNMYGGGTINGNGQVWYDLYAEDDLILRPVLMGIIGLNGGT
IGPLKLRYSPQYYHFVANSSNVLFDGIDISGYSTSDNEAKNTDGWDTYRSNNIVIQNSVI
NNGDDCVSFKPNSTNILVQNLHCNGSHGISVGSLGQYKDEVDIVENVYVYNISMFNASDM
ARIKVWPGTPSALSADLQGGGGSGSVKNITYDTALIDNVDWAIEITQCYGQKNTTLCNEY
PSSLTISDVHIKNFRGTTSGSEDPYVGTIVCSSPDTCSDIYTSNINVTSPDGTNDFVCDN
VDESLLSVNCTATSA

Enzyme Prediction     

EC	3.2.1.67:7	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	70	424	1.4e-72	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.32e-39	139	421	54	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	4.82e-29	40	414	37	401	Probable polygalacturonase
215120	PLN02188	3.74e-28	190	421	176	390	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	3.24e-26	138	409	113	359	Probable polygalacturonase At3g15720
215540	PLN03010	3.50e-26	54	422	54	390	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02851.1|GH28	1.31e-317	1	434	1	434
CAA68128.1|GH28|3.2.1.67	1.31e-317	1	434	1	434
BCS14503.1|GH28	1.31e-317	1	434	1	434
ABD61562.1|GH28	6.44e-316	1	434	1	434
CAK46374.1|GH28	6.44e-316	1	434	1	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.49e-70	32	432	1	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	1.91e-22	89	399	35	313	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1HG8_A	2.47e-19	98	404	32	329	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1NHC_A	3.89e-19	126	399	47	310	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	4.78e-18	90	393	24	318	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00293|PGLRX_ASPTU	2.33e-318	1	434	1	434	Exopolygalacturonase X OS=Aspergillus tubingensis OX=5068 GN=pgaX PE=1 SV=1
sp|A2R060|PGLRX_ASPNC	1.14e-316	1	434	1	434	Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaX PE=3 SV=1
sp|Q27UB3|PGLRX_ASPNG	1.14e-316	1	434	1	434	Exopolygalacturonase X OS=Aspergillus niger OX=5061 GN=pgaX PE=3 SV=1
sp|Q5ASG9|PGLX1_EMENI	1.31e-246	1	432	1	433	Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgaX-1 PE=1 SV=1
sp|Q0CGP0|PGLRX_ASPTN	1.31e-246	1	432	1	433	Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004200	0.995776	CS pos: 22-23. Pr: 0.8849

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_197726-t33_1-p1.