CAZyme Information: ASPBRDRAFT_190242-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_190242-t33_1-p1
• CAZy Family: GH131
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516		56846.12	4.9908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878679:417937-419710(-)

Full Sequence      

MPSLASLTAIAILIPLAVSNQSSNPNVTSTIKISPAATPRPGKQIVDAAYQSFSIEFSFM
ADYAGNDTHPNQFSRQVIQNLYDISGAYPIFRVGGSTQSSAIYYPNQTEAIIDPFDSVAS
DQPSHTFVGPSWFQSFRQFPNGTQYIYGLNFFNTVNETYYNIGNGLDQCVLEANAAYETM
GNSLYAYEIGNEVDGWGNGKHREGNWTVQRYVNQWNEFATAISRNLTGKDAARLFQGCAF
EAPRHISERTDWNVENAELDGMSQDKAKTVSDHEYMGANCHYTGAGPTIADTLFDRTNML
SRVWYHDYLGNATANSGIKYVIGETNSISCQGAFNISDVMASAVWAVDYVMYLSSLRVSR
VHFHMGTRYRYSPWQPIFYNDNAFHVNPMYYGNLFNAAVFAGGNKQTEVLVNETNFGAYA
VYSSGSLDSIVAVNLNIWNSTFDPVARPYTALALPGDWQDAKVSRLTSPGVDIAGNITFA
GQYVDETGRIVGKKTYDKVDGGKVLVGAGEAVLVQK

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_190242-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	48	447	5.9e-82	0.8483516483516483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.02e-19	418	513	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41913.1|GH79	0.0	3	516	4	518
BCR99142.1|GH79	0.0	60	516	1	457
QMW44049.1|GH79	9.35e-315	1	516	1	513
QMW32021.1|GH79	9.35e-315	1	516	1	513
BAE62550.1|GH79	6.12e-313	1	516	1	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	8.35e-20	78	514	47	457	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5BWI_A	2.25e-15	22	443	10	373	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]
5G0M_A	2.47e-14	21	488	10	443	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	2.57e-14	21	488	10	443	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	6.15e-14	21	488	30	463	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	2.91e-51	28	441	32	443	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	1.03e-49	22	441	11	442	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999719	CS pos: 19-20. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_190242-t33_1-p1.