CAZyme Information: ASPBRDRAFT_181673-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_181673-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610	KV878687|CGC3	66102.47	4.9686

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878687:909044-911353(-)

Full Sequence      

MRSPLFWLPLAAFILFHATIISCESITASGLLGSHFGIPGLNATYDYVIIGGGTAGLTVA
RRLAETPSVSVAVIEAGDFPQFSNGNYSEVPAYASEFTGSDPTLKNPALDWYMYTTPQEQ
LNGRTALFDSGKIISGSSGRNFLWQVRGTRGCFDRWAQEVDDPSYQYESFLPYFQRYAHF
HLPNATNVTYNLSDWSPQGGPVQVGYPSWVNPISAWLGRGFTEMGMQALPSLLSGDLMGW
SWLSQTLDPVTQTRSSSLAFLEEALAESSNLVLYKSTLAQKITFQDERATGVLVDTAGQV
YHVAARREVVLSAGVMRSPQLLMVSGIGPRETLQAHGIPVVADRPGVGQNMADNVLVGPT
YQVRVTTHNSLADPAYLAASIAEYNVNRTGMLTNVGGDVAAFEQIPPSMLHPETSQALND
TFPPDWPHIEYLVLDEYFATGADSSRGVSNMKQYVAASVGLVATFSRGNVTIASSDAATN
PIISPNWLLDPRDQDVALAAFTRARQLFNTTAMQPVVMSEAFPGANYTSRADLLRIIRES
ANSVYNAVGSNRMGRITDREAVVDSRCRVIGVQSLRVVDASAFPFLPPGQPSATVYALAE
KIAADMRQSG

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_181673-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	44	607	2.7e-168	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.42e-87	42	606	5	532	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.30e-86	44	607	5	532	choline dehydrogenase; Validated
274888	Rv0697	1.77e-48	46	604	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	7.72e-38	465	602	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.65e-24	34	595	45	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ31585.1|AA3_2	6.63e-200	18	604	17	615
VBB75829.1|AA3_2	3.07e-172	26	606	57	641
AAC49318.1|AA3_2	8.15e-172	26	606	55	639
AAC49319.1|AA3_2	8.15e-172	26	606	55	639
AAS66012.1|AA3_2	8.15e-172	26	606	55	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.38e-62	41	603	2	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	3.96e-53	45	609	41	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	6.17e-49	43	606	1	561	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	8.34e-49	45	601	2	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6O9N_A	2.43e-47	18	603	6	635	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12062|AFLK_ASPPU	1.45e-172	26	606	55	639	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|A4UHS8|VBSA_DOTSE	1.39e-165	26	606	56	643	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2
sp|M2Y151|VBSA_DOTSN	1.39e-165	26	606	56	643	Versicolorin B synthase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=vbsA PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	1.94e-163	28	606	36	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|C8VDT4|STCN_EMENI	1.76e-161	26	606	48	635	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001200	0.998772	CS pos: 23-24. Pr: 0.9665

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_181673-t33_1-p1.