CAZyme Information: ASPBRDRAFT_181256-t33_1-p1

Basic Information

• Species: Aspergillus brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus brasiliensis
• CAZyme ID: ASPBRDRAFT_181256-t33_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	KV878687|CGC3	68032.14	6.1101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AbrasiliensisCBS101740	13263	767769	274	12989

• Gene Location: location=KV878687:215150-217079(-)

Full Sequence      

MEPTPITDFIHDTFDFIIVGGGTAGLVLAARLSENASIRVGVIEAGLSRIGDPKVDTPTG
MAMTLKDPEYDWCFRSAPQTGANNRTYTTHCGKMLGGSSGFNFMMSGRPTADEINDWGKT
TGVKGWSWSDLLPYFKKHEKLEVDQPNITSRDMDTCPLEPDLHGTDGPIHNSFGTWHAPF
ERDLLPALDTVSGLSRPREPYAGTHLGFYRTLFTIDRTGKPLRSYAASEYLAPNHHAGRS
NLRVLTDALVCKITLGTNEHSERQATGVELLYQGISYTVRPRKEVILSAGTVHSPRLLEL
SGIGDPNVLCRVGIPCIVPNMDVGNNLQEQALCSVVYELASGYTSVDSLLRDKDIFAEHQ
RLYEEEHSGALSGSLSITGYTSYATQVEQHDLEDTVACFLDPKNASTKQDTVLQNKQRKI
LAARIQDPTCPCIQYMCAPENFSTAHAVDNLGAVMSGPPSGYNDCFSITTSQMHPVSRGR
VHVVSDDPKEPPDISPGLLAHPADVDVLAAGVGFAERVFRSEFVRDKVARKVRPDPRVDI
GVRDEVKRFVRENTIPFQHLVGTCALGMVVDERLRVKRVKGLRVVDASVVPMMVSPSLAA
VVYAVAEKAAYLIKEDYGLAE

Enzyme Prediction     

No EC number prediction in ASPBRDRAFT_181256-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	616	4.7e-163	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.22e-86	10	620	4	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.85e-77	13	614	5	532	choline dehydrogenase; Validated
274888	Rv0697	1.45e-43	15	610	2	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	3.97e-31	475	609	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.21e-25	1	589	43	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL00904.1|AA3_2	0.0	1	619	1	617
BCS03047.1|AA3_2	0.0	1	619	1	617
BCS14695.1|AA3_2	0.0	1	619	1	617
ATZ47931.1|AA3_2	1.33e-240	1	620	1	621
UPX44764.1|AA3_2	6.67e-226	1	618	1	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	7.34e-55	14	616	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4H7U_A	1.93e-54	14	617	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	3.76e-54	14	616	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	2.06e-53	13	616	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.34e-50	10	620	2	589	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	5.70e-232	1	617	1	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.22e-224	1	618	1	613	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.22e-224	1	618	1	613	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.88e-78	3	616	29	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.31e-65	8	613	41	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999743	0.000306

TMHMM  Annotations     

There is no transmembrane helices in ASPBRDRAFT_181256-t33_1-p1.